BLASTX nr result
ID: Rehmannia29_contig00027929
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00027929 (737 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_717523.1| hypothetical protein TATV_DAH68_216 [Taterapox ... 53 8e-06 >ref|YP_717523.1| hypothetical protein TATV_DAH68_216 [Taterapox virus] gb|ABD97782.1| unknown [Taterapox virus] Length = 68 Score = 52.8 bits (125), Expect = 8e-06 Identities = 31/58 (53%), Positives = 39/58 (67%) Frame = +2 Query: 470 IL*ISTLVYNLLHSSITLYNILDYSRMFYITLPYSRLFYNILDPSIIFLTLLKYSRLF 643 IL S L Y++L SI Y+IL YS +FY L YS LFY+IL SI+F ++L YS LF Sbjct: 3 ILIYSILFYSILFYSILFYSILFYSILFYSILFYSILFYSILFYSILFYSILFYSILF 60