BLASTX nr result
ID: Rehmannia29_contig00027886
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00027886 (449 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV51945.1| RNA exonuclease 4 [Dorcoceras hygrometricum] 59 2e-07 ref|XP_012847956.1| PREDICTED: RNA exonuclease 4 [Erythranthe gu... 57 9e-07 ref|XP_022893208.1| RNA exonuclease 4 isoform X2 [Olea europaea ... 54 8e-06 ref|XP_022893207.1| RNA exonuclease 4 isoform X1 [Olea europaea ... 54 8e-06 >gb|KZV51945.1| RNA exonuclease 4 [Dorcoceras hygrometricum] Length = 243 Score = 58.9 bits (141), Expect = 2e-07 Identities = 29/34 (85%), Positives = 29/34 (85%) Frame = -2 Query: 448 EGRSRSLKNLAAEFLNVEIQNGEHCPVSSFPLII 347 EGRSRSLKNLA EFL V IQNGEHCPVS PLII Sbjct: 199 EGRSRSLKNLAMEFLGVGIQNGEHCPVSFSPLII 232 >ref|XP_012847956.1| PREDICTED: RNA exonuclease 4 [Erythranthe guttata] gb|EYU44986.1| hypothetical protein MIMGU_mgv1a012083mg [Erythranthe guttata] gb|EYU44987.1| hypothetical protein MIMGU_mgv1a012083mg [Erythranthe guttata] Length = 262 Score = 57.0 bits (136), Expect = 9e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -2 Query: 448 EGRSRSLKNLAAEFLNVEIQNGEHCPV 368 EGRSRSLKNLAAEFLNV+IQNGEHCP+ Sbjct: 190 EGRSRSLKNLAAEFLNVDIQNGEHCPI 216 >ref|XP_022893208.1| RNA exonuclease 4 isoform X2 [Olea europaea var. sylvestris] Length = 250 Score = 54.3 bits (129), Expect = 8e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -2 Query: 448 EGRSRSLKNLAAEFLNVEIQNGEHCPV 368 EGRSRSLKNLA++FL+VEIQNGEHCPV Sbjct: 179 EGRSRSLKNLASQFLDVEIQNGEHCPV 205 >ref|XP_022893207.1| RNA exonuclease 4 isoform X1 [Olea europaea var. sylvestris] Length = 256 Score = 54.3 bits (129), Expect = 8e-06 Identities = 24/27 (88%), Positives = 27/27 (100%) Frame = -2 Query: 448 EGRSRSLKNLAAEFLNVEIQNGEHCPV 368 EGRSRSLKNLA++FL+VEIQNGEHCPV Sbjct: 185 EGRSRSLKNLASQFLDVEIQNGEHCPV 211