BLASTX nr result
ID: Rehmannia29_contig00027798
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00027798 (1856 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_024195633.1| uncharacterized protein LOC112198748 [Rosa c... 62 6e-07 ref|XP_017181625.1| PREDICTED: uncharacterized protein LOC108170... 61 2e-06 >ref|XP_024195633.1| uncharacterized protein LOC112198748 [Rosa chinensis] Length = 242 Score = 62.0 bits (149), Expect = 6e-07 Identities = 25/50 (50%), Positives = 34/50 (68%) Frame = -3 Query: 819 VWKAPVLKKVQLFSWLLVKGKLLTCDVLQKRFPYASLSPNWCVLCRNHSE 670 +WK V KV++ WL+V GK TCDVLQ+R P + SP+WC+LC+ E Sbjct: 73 IWKVKVPTKVKILGWLVVLGKTNTCDVLQRRRPGSCFSPHWCILCKAQGE 122 >ref|XP_017181625.1| PREDICTED: uncharacterized protein LOC108170764 [Malus domestica] Length = 262 Score = 60.8 bits (146), Expect = 2e-06 Identities = 24/50 (48%), Positives = 34/50 (68%) Frame = -3 Query: 819 VWKAPVLKKVQLFSWLLVKGKLLTCDVLQKRFPYASLSPNWCVLCRNHSE 670 +WKA V KV++ WL+ K+ TCD +Q+R PY SP+WCVLC++ E Sbjct: 93 IWKAKVPPKVKVLVWLVALRKVNTCDQIQRRMPYTCFSPHWCVLCKSGEE 142