BLASTX nr result
ID: Rehmannia29_contig00027656
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00027656 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV25510.1| replication protein A 70 kDa DNA-binding subunit ... 42 3e-06 gb|KZV17224.1| Replication protein A 70 kDa DNA-binding subunit ... 39 7e-06 >gb|KZV25510.1| replication protein A 70 kDa DNA-binding subunit B-like [Dorcoceras hygrometricum] Length = 161 Score = 41.6 bits (96), Expect(2) = 3e-06 Identities = 16/35 (45%), Positives = 29/35 (82%) Frame = -2 Query: 197 LTDVIGRMTAKNSPQHKQIAGRQTKMIDIVLENIQ 93 L DVIG++ A++SPQ ++ GR+T+++DIVL++ + Sbjct: 122 LFDVIGQVVARDSPQSREFGGRETRLLDIVLQDYE 156 Score = 37.0 bits (84), Expect(2) = 3e-06 Identities = 17/41 (41%), Positives = 28/41 (68%) Frame = -1 Query: 396 IIFVGKTLLTEFFDDDFPCMIYDFKPFDSFTDVDFIDESIL 274 I F+ KT + E FDD FP +++DFK F+ + + I+E++L Sbjct: 83 INFITKTHVCEIFDDSFPSIMFDFKSFNDVKNAE-IEETML 122 >gb|KZV17224.1| Replication protein A 70 kDa DNA-binding subunit [Dorcoceras hygrometricum] Length = 388 Score = 39.3 bits (90), Expect(2) = 7e-06 Identities = 17/37 (45%), Positives = 28/37 (75%) Frame = -2 Query: 197 LTDVIGRMTAKNSPQHKQIAGRQTKMIDIVLENIQ*N 87 L DVIG++ A++SPQ K+ GR+T+++ IVL + + N Sbjct: 202 LFDVIGQVVARDSPQSKEFGGRETRLLYIVLHDYEDN 238 Score = 38.1 bits (87), Expect(2) = 7e-06 Identities = 18/41 (43%), Positives = 28/41 (68%) Frame = -1 Query: 396 IIFVGKTLLTEFFDDDFPCMIYDFKPFDSFTDVDFIDESIL 274 I F+ KT + E FDD FP M++DFK F + + + I+E++L Sbjct: 163 INFITKTHVCEIFDDSFPSMMFDFKSFTNVKNAE-IEETML 202