BLASTX nr result
ID: Rehmannia29_contig00027645
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00027645 (1598 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN05888.1| hypothetical protein CDL12_21568 [Handroanthus im... 57 7e-06 >gb|PIN05888.1| hypothetical protein CDL12_21568 [Handroanthus impetiginosus] Length = 178 Score = 57.4 bits (137), Expect = 7e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 304 EYYTYILGQRFYSESDLMRNIIDAKKRGLAIYAP 203 +YYT ILGQ+FYSE DL+RNI DAK RGL+IYAP Sbjct: 27 KYYTNILGQKFYSEEDLLRNIWDAKARGLSIYAP 60