BLASTX nr result
ID: Rehmannia29_contig00027396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00027396 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN26934.1| hypothetical protein CDL12_00291 [Handroanthus im... 60 1e-07 ref|XP_011072452.1| protein CHUP1, chloroplastic [Sesamum indicum] 59 2e-07 gb|PIN17098.1| hypothetical protein CDL12_10239 [Handroanthus im... 59 2e-07 >gb|PIN26934.1| hypothetical protein CDL12_00291 [Handroanthus impetiginosus] Length = 566 Score = 60.1 bits (144), Expect = 1e-07 Identities = 27/36 (75%), Positives = 32/36 (88%) Frame = -3 Query: 185 MAVKEKRDNPITPVLFKFGVVLAFSLGGIVYTFFRN 78 M VKEKR++P+ PVLFKFGV LAFSLGGIVY+ FR+ Sbjct: 1 MVVKEKRESPVGPVLFKFGVALAFSLGGIVYSLFRS 36 >ref|XP_011072452.1| protein CHUP1, chloroplastic [Sesamum indicum] Length = 630 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 185 MAVKEKRDNPITPVLFKFGVVLAFSLGGIVYTFFRN 78 M VKEKR++PI+PVL K G LAFSLGGIVYTFFR+ Sbjct: 1 MGVKEKRESPISPVLLKLGAALAFSLGGIVYTFFRS 36 >gb|PIN17098.1| hypothetical protein CDL12_10239 [Handroanthus impetiginosus] Length = 566 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/36 (72%), Positives = 32/36 (88%) Frame = -3 Query: 185 MAVKEKRDNPITPVLFKFGVVLAFSLGGIVYTFFRN 78 M +KEKR++P+ PVLFKFGV LAFSLGGIVY+ FR+ Sbjct: 1 MGLKEKRESPVGPVLFKFGVALAFSLGGIVYSLFRS 36