BLASTX nr result
ID: Rehmannia29_contig00027322
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00027322 (1105 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM98632.1| hypothetical protein CDL12_28885 [Handroanthus im... 173 1e-47 ref|XP_011071081.1| probable xyloglucan endotransglucosylase/hyd... 172 3e-47 ref|XP_011086549.1| probable xyloglucan endotransglucosylase/hyd... 167 2e-45 ref|XP_004238674.1| PREDICTED: probable xyloglucan endotransgluc... 166 4e-45 ref|XP_022851630.1| probable xyloglucan endotransglucosylase/hyd... 166 5e-45 ref|XP_015075129.1| PREDICTED: probable xyloglucan endotransgluc... 166 5e-45 ref|XP_006355979.2| PREDICTED: probable xyloglucan endotransgluc... 166 8e-45 ref|XP_019245065.1| PREDICTED: probable xyloglucan endotransgluc... 166 1e-44 gb|PHU02822.1| putative xyloglucan endotransglucosylase/hydrolas... 166 1e-44 gb|PHT68195.1| putative xyloglucan endotransglucosylase/hydrolas... 166 1e-44 gb|EYU22485.1| hypothetical protein MIMGU_mgv1a023829mg, partial... 164 1e-44 ref|XP_022851631.1| probable xyloglucan endotransglucosylase/hyd... 165 2e-44 ref|XP_016466905.1| PREDICTED: probable xyloglucan endotransgluc... 165 2e-44 ref|XP_009795133.1| PREDICTED: probable xyloglucan endotransgluc... 165 2e-44 ref|XP_016548107.1| PREDICTED: probable xyloglucan endotransgluc... 166 2e-44 ref|XP_012855354.1| PREDICTED: probable xyloglucan endotransgluc... 164 2e-44 gb|OIT31385.1| putative xyloglucan endotransglucosylasehydrolase... 162 1e-43 ref|XP_019227452.1| PREDICTED: probable xyloglucan endotransgluc... 162 2e-43 ref|XP_009623898.1| PREDICTED: probable xyloglucan endotransgluc... 162 2e-43 ref|XP_010913577.1| PREDICTED: probable xyloglucan endotransgluc... 162 3e-43 >gb|PIM98632.1| hypothetical protein CDL12_28885 [Handroanthus impetiginosus] Length = 313 Score = 173 bits (439), Expect = 1e-47 Identities = 77/80 (96%), Positives = 79/80 (98%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSV TGREEKFYLWFDPT+DFHDY Sbjct: 111 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVSTGREEKFYLWFDPTQDFHDY 170 Query: 62 SILWNNHHIVFLVDNIPVRE 3 SILWNNHHIVFLVDN+PVRE Sbjct: 171 SILWNNHHIVFLVDNVPVRE 190 >ref|XP_011071081.1| probable xyloglucan endotransglucosylase/hydrolase protein 33 [Sesamum indicum] Length = 312 Score = 172 bits (436), Expect = 3e-47 Identities = 77/80 (96%), Positives = 79/80 (98%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTE FH+Y Sbjct: 112 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEGFHNY 171 Query: 62 SILWNNHHIVFLVDNIPVRE 3 SILWNNHHIVFLVDN+PVRE Sbjct: 172 SILWNNHHIVFLVDNVPVRE 191 >ref|XP_011086549.1| probable xyloglucan endotransglucosylase/hydrolase protein 33 [Sesamum indicum] Length = 314 Score = 167 bits (424), Expect = 2e-45 Identities = 73/80 (91%), Positives = 78/80 (97%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSNAD +PHNHDEIDIELLGHEKRRDWVLQTNIYGNGSV TGREEKFYLWFDPT++FHDY Sbjct: 112 LSNADSYPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVSTGREEKFYLWFDPTQNFHDY 171 Query: 62 SILWNNHHIVFLVDNIPVRE 3 SILWNNHHIVFLVDN+P+RE Sbjct: 172 SILWNNHHIVFLVDNVPIRE 191 >ref|XP_004238674.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Solanum lycopersicum] Length = 313 Score = 166 bits (421), Expect = 4e-45 Identities = 72/80 (90%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 +SN+DVFPHNHDEID ELLGHEKRRDWVLQTN+YGNGSV TGREEKFYLWFDPT DFHDY Sbjct: 113 MSNSDVFPHNHDEIDFELLGHEKRRDWVLQTNLYGNGSVHTGREEKFYLWFDPTLDFHDY 172 Query: 62 SILWNNHHIVFLVDNIPVRE 3 +ILWNNHHIVFLVDN+PVRE Sbjct: 173 TILWNNHHIVFLVDNVPVRE 192 >ref|XP_022851630.1| probable xyloglucan endotransglucosylase/hydrolase protein 33 [Olea europaea var. sylvestris] Length = 314 Score = 166 bits (421), Expect = 5e-45 Identities = 72/80 (90%), Positives = 78/80 (97%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSNADVFPHNHDE+DIELLGHE+R+DWVLQTNIYGNGSV+TGREEKFYLWFDPT FH+Y Sbjct: 111 LSNADVFPHNHDELDIELLGHERRKDWVLQTNIYGNGSVKTGREEKFYLWFDPTTSFHEY 170 Query: 62 SILWNNHHIVFLVDNIPVRE 3 SILWNNHHIVFLVDN+PVRE Sbjct: 171 SILWNNHHIVFLVDNVPVRE 190 >ref|XP_015075129.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Solanum pennellii] Length = 316 Score = 166 bits (421), Expect = 5e-45 Identities = 72/80 (90%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 +SN+DVFPHNHDEID ELLGHEKRRDWVLQTN+YGNGSV TGREEKFYLWFDPT DFHDY Sbjct: 113 MSNSDVFPHNHDEIDFELLGHEKRRDWVLQTNLYGNGSVHTGREEKFYLWFDPTLDFHDY 172 Query: 62 SILWNNHHIVFLVDNIPVRE 3 +ILWNNHHIVFLVDN+PVRE Sbjct: 173 TILWNNHHIVFLVDNVPVRE 192 >ref|XP_006355979.2| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Solanum tuberosum] Length = 323 Score = 166 bits (420), Expect = 8e-45 Identities = 71/80 (88%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 +SN+DVFPHNHDEID ELLGHEKRRDWVLQTN+YGNGSV TGREEKFYLWFDPT DFHDY Sbjct: 113 MSNSDVFPHNHDEIDFELLGHEKRRDWVLQTNLYGNGSVHTGREEKFYLWFDPTLDFHDY 172 Query: 62 SILWNNHHIVFLVDNIPVRE 3 +ILWNNHHIVFLVDN+P+RE Sbjct: 173 TILWNNHHIVFLVDNVPIRE 192 >ref|XP_019245065.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Nicotiana attenuata] gb|OIT04125.1| putative xyloglucan endotransglucosylasehydrolase protein 33 [Nicotiana attenuata] Length = 317 Score = 166 bits (419), Expect = 1e-44 Identities = 71/80 (88%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSN+DVFPHNHDEID ELLGH+KRRDWVLQTN+YGNGSV TGREEKFYLWFDPT DFHDY Sbjct: 113 LSNSDVFPHNHDEIDFELLGHDKRRDWVLQTNLYGNGSVHTGREEKFYLWFDPTLDFHDY 172 Query: 62 SILWNNHHIVFLVDNIPVRE 3 +ILWNNHHIVFLVDN+P+RE Sbjct: 173 TILWNNHHIVFLVDNVPIRE 192 >gb|PHU02822.1| putative xyloglucan endotransglucosylase/hydrolase protein 33 [Capsicum chinense] Length = 320 Score = 166 bits (419), Expect = 1e-44 Identities = 71/80 (88%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSN+D+FPHNHDEID ELLGHEKRRDWVLQTN+YGNGSV TGREEKFYLWFDPT DFHDY Sbjct: 113 LSNSDMFPHNHDEIDFELLGHEKRRDWVLQTNLYGNGSVHTGREEKFYLWFDPTLDFHDY 172 Query: 62 SILWNNHHIVFLVDNIPVRE 3 +ILWNNHHIVFLVDN+P+RE Sbjct: 173 TILWNNHHIVFLVDNVPIRE 192 >gb|PHT68195.1| putative xyloglucan endotransglucosylase/hydrolase protein 33 [Capsicum annuum] Length = 320 Score = 166 bits (419), Expect = 1e-44 Identities = 71/80 (88%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSN+D+FPHNHDEID ELLGHEKRRDWVLQTN+YGNGSV TGREEKFYLWFDPT DFHDY Sbjct: 113 LSNSDMFPHNHDEIDFELLGHEKRRDWVLQTNLYGNGSVHTGREEKFYLWFDPTLDFHDY 172 Query: 62 SILWNNHHIVFLVDNIPVRE 3 +ILWNNHHIVFLVDN+P+RE Sbjct: 173 TILWNNHHIVFLVDNVPIRE 192 >gb|EYU22485.1| hypothetical protein MIMGU_mgv1a023829mg, partial [Erythranthe guttata] Length = 289 Score = 164 bits (416), Expect = 1e-44 Identities = 73/80 (91%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSNAD FPHNHDEIDIELLGHEKR++WVLQTNIYGNGSV TGREEKFYLWFDPT+ FH+Y Sbjct: 86 LSNADAFPHNHDEIDIELLGHEKRKEWVLQTNIYGNGSVSTGREEKFYLWFDPTQAFHNY 145 Query: 62 SILWNNHHIVFLVDNIPVRE 3 SILWNNHHIVFLVDNIPVRE Sbjct: 146 SILWNNHHIVFLVDNIPVRE 165 >ref|XP_022851631.1| probable xyloglucan endotransglucosylase/hydrolase protein 33 [Olea europaea var. sylvestris] Length = 314 Score = 165 bits (417), Expect = 2e-44 Identities = 72/80 (90%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSNADV PHNHDEIDIELLGHE+R+DWVLQTNIYGNGSV+TGREEKFYLWFDPT FH+Y Sbjct: 111 LSNADVLPHNHDEIDIELLGHERRKDWVLQTNIYGNGSVKTGREEKFYLWFDPTTSFHEY 170 Query: 62 SILWNNHHIVFLVDNIPVRE 3 SILWNNHHIVFLVDN+PVRE Sbjct: 171 SILWNNHHIVFLVDNVPVRE 190 >ref|XP_016466905.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Nicotiana tabacum] Length = 316 Score = 165 bits (417), Expect = 2e-44 Identities = 70/80 (87%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 +SN+DVFPHNHDEID ELLGH+KRRDWVLQTN+YGNGSV TGREEKFYLWFDPT DFHDY Sbjct: 113 MSNSDVFPHNHDEIDFELLGHDKRRDWVLQTNLYGNGSVHTGREEKFYLWFDPTLDFHDY 172 Query: 62 SILWNNHHIVFLVDNIPVRE 3 +ILWNNHHIVFLVDN+P+RE Sbjct: 173 TILWNNHHIVFLVDNVPIRE 192 >ref|XP_009795133.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Nicotiana sylvestris] Length = 316 Score = 165 bits (417), Expect = 2e-44 Identities = 70/80 (87%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 +SN+DVFPHNHDEID ELLGH+KRRDWVLQTN+YGNGSV TGREEKFYLWFDPT DFHDY Sbjct: 113 MSNSDVFPHNHDEIDFELLGHDKRRDWVLQTNLYGNGSVHTGREEKFYLWFDPTLDFHDY 172 Query: 62 SILWNNHHIVFLVDNIPVRE 3 +ILWNNHHIVFLVDN+P+RE Sbjct: 173 TILWNNHHIVFLVDNVPIRE 192 >ref|XP_016548107.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Capsicum annuum] Length = 349 Score = 166 bits (419), Expect = 2e-44 Identities = 71/80 (88%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSN+D+FPHNHDEID ELLGHEKRRDWVLQTN+YGNGSV TGREEKFYLWFDPT DFHDY Sbjct: 142 LSNSDMFPHNHDEIDFELLGHEKRRDWVLQTNLYGNGSVHTGREEKFYLWFDPTLDFHDY 201 Query: 62 SILWNNHHIVFLVDNIPVRE 3 +ILWNNHHIVFLVDN+P+RE Sbjct: 202 TILWNNHHIVFLVDNVPIRE 221 >ref|XP_012855354.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Erythranthe guttata] Length = 314 Score = 164 bits (416), Expect = 2e-44 Identities = 73/80 (91%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSNAD FPHNHDEIDIELLGHEKR++WVLQTNIYGNGSV TGREEKFYLWFDPT+ FH+Y Sbjct: 111 LSNADAFPHNHDEIDIELLGHEKRKEWVLQTNIYGNGSVSTGREEKFYLWFDPTQAFHNY 170 Query: 62 SILWNNHHIVFLVDNIPVRE 3 SILWNNHHIVFLVDNIPVRE Sbjct: 171 SILWNNHHIVFLVDNIPVRE 190 >gb|OIT31385.1| putative xyloglucan endotransglucosylasehydrolase protein 33 [Nicotiana attenuata] Length = 297 Score = 162 bits (410), Expect = 1e-43 Identities = 69/80 (86%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSN ++FPHNHDE+D ELLG++KRRDWVLQTNIYGNGSV TGREEKFYLWFDPT+DFHDY Sbjct: 94 LSNQNIFPHNHDELDFELLGYDKRRDWVLQTNIYGNGSVSTGREEKFYLWFDPTQDFHDY 153 Query: 62 SILWNNHHIVFLVDNIPVRE 3 SILWNNHHI+FLVDN+PVRE Sbjct: 154 SILWNNHHILFLVDNVPVRE 173 >ref|XP_019227452.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Nicotiana attenuata] Length = 316 Score = 162 bits (410), Expect = 2e-43 Identities = 69/80 (86%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSN ++FPHNHDE+D ELLG++KRRDWVLQTNIYGNGSV TGREEKFYLWFDPT+DFHDY Sbjct: 113 LSNQNIFPHNHDELDFELLGYDKRRDWVLQTNIYGNGSVSTGREEKFYLWFDPTQDFHDY 172 Query: 62 SILWNNHHIVFLVDNIPVRE 3 SILWNNHHI+FLVDN+PVRE Sbjct: 173 SILWNNHHILFLVDNVPVRE 192 >ref|XP_009623898.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Nicotiana tomentosiformis] ref|XP_016455686.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Nicotiana tabacum] Length = 316 Score = 162 bits (410), Expect = 2e-43 Identities = 69/80 (86%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 LSN ++FPHNHDE+D ELLG++KRRDWVLQTNIYGNGSV TGREEKFYLWFDPT+DFHDY Sbjct: 113 LSNQNIFPHNHDELDFELLGYDKRRDWVLQTNIYGNGSVSTGREEKFYLWFDPTQDFHDY 172 Query: 62 SILWNNHHIVFLVDNIPVRE 3 SILWNNHHI+FLVDN+PVRE Sbjct: 173 SILWNNHHILFLVDNVPVRE 192 >ref|XP_010913577.1| PREDICTED: probable xyloglucan endotransglucosylase/hydrolase protein 33 [Elaeis guineensis] Length = 319 Score = 162 bits (409), Expect = 3e-43 Identities = 70/80 (87%), Positives = 77/80 (96%) Frame = -3 Query: 242 LSNADVFPHNHDEIDIELLGHEKRRDWVLQTNIYGNGSVRTGREEKFYLWFDPTEDFHDY 63 +SNADV+PHNHDEID ELLGHEKR++WVLQTNIYGNGSV TGREEKFY+WFDPT DFH+Y Sbjct: 113 MSNADVYPHNHDEIDFELLGHEKRKEWVLQTNIYGNGSVGTGREEKFYMWFDPTADFHEY 172 Query: 62 SILWNNHHIVFLVDNIPVRE 3 SILWN+HHIVFLVDNIPVRE Sbjct: 173 SILWNSHHIVFLVDNIPVRE 192