BLASTX nr result
ID: Rehmannia29_contig00027321
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00027321 (601 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100624.1| scarecrow-like protein 21 [Sesamum indicum] ... 70 2e-10 ref|XP_012830818.1| PREDICTED: scarecrow-like protein 21 [Erythr... 69 5e-10 >ref|XP_011100624.1| scarecrow-like protein 21 [Sesamum indicum] ref|XP_011100625.1| scarecrow-like protein 21 [Sesamum indicum] Length = 546 Score = 70.1 bits (170), Expect = 2e-10 Identities = 30/44 (68%), Positives = 35/44 (79%) Frame = +1 Query: 469 MQASQHHSRSSMHNTLCCQPVRKLEAYSLQQCQPLNPQHSTYNN 600 MQA Q+HSRS M NTLCC+P+ KLE SLQ CQP+NP H +YNN Sbjct: 1 MQACQYHSRSGMTNTLCCRPIGKLENCSLQPCQPINPHHLSYNN 44 >ref|XP_012830818.1| PREDICTED: scarecrow-like protein 21 [Erythranthe guttata] gb|EYU42749.1| hypothetical protein MIMGU_mgv1a005166mg [Erythranthe guttata] Length = 494 Score = 68.6 bits (166), Expect = 5e-10 Identities = 31/43 (72%), Positives = 35/43 (81%) Frame = +1 Query: 469 MQASQHHSRSSMHNTLCCQPVRKLEAYSLQQCQPLNPQHSTYN 597 MQAS HHSRS M NTLCCQPV K E+YS QQC LNPQ+S++N Sbjct: 1 MQASGHHSRSRMPNTLCCQPVLKFESYSPQQCHNLNPQNSSHN 43