BLASTX nr result
ID: Rehmannia29_contig00027015
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00027015 (475 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012842673.1| PREDICTED: CWF19-like protein 2 isoform X2 [... 55 9e-06 ref|XP_012842671.1| PREDICTED: CWF19-like protein 2 isoform X1 [... 55 9e-06 >ref|XP_012842673.1| PREDICTED: CWF19-like protein 2 isoform X2 [Erythranthe guttata] Length = 769 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 104 MLSGLKFIPRDQVDQAKDETPNDSEKETRKSGHR 3 MLSGLKFIPRDQ+D+ KD+T NDS + T+KS HR Sbjct: 1 MLSGLKFIPRDQIDKEKDDTVNDSRRGTKKSAHR 34 >ref|XP_012842671.1| PREDICTED: CWF19-like protein 2 isoform X1 [Erythranthe guttata] ref|XP_012842672.1| PREDICTED: CWF19-like protein 2 isoform X1 [Erythranthe guttata] gb|EYU32986.1| hypothetical protein MIMGU_mgv1a001703mg [Erythranthe guttata] Length = 770 Score = 55.1 bits (131), Expect = 9e-06 Identities = 24/34 (70%), Positives = 29/34 (85%) Frame = -3 Query: 104 MLSGLKFIPRDQVDQAKDETPNDSEKETRKSGHR 3 MLSGLKFIPRDQ+D+ KD+T NDS + T+KS HR Sbjct: 1 MLSGLKFIPRDQIDKEKDDTVNDSRRGTKKSAHR 34