BLASTX nr result
ID: Rehmannia29_contig00026964
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00026964 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012832347.1| PREDICTED: non-specific lipid-transfer prote... 72 1e-12 gb|PIN22564.1| hypothetical protein CDL12_04717 [Handroanthus im... 65 3e-10 ref|XP_020552772.1| non-specific lipid-transfer protein-like pro... 63 2e-09 ref|XP_011091038.2| non-specific lipid-transfer protein-like pro... 63 2e-09 >ref|XP_012832347.1| PREDICTED: non-specific lipid-transfer protein-like protein At2g13820 [Erythranthe guttata] gb|EYU41466.1| hypothetical protein MIMGU_mgv1a023645mg [Erythranthe guttata] Length = 187 Score = 71.6 bits (174), Expect = 1e-12 Identities = 41/64 (64%), Positives = 49/64 (76%), Gaps = 5/64 (7%) Frame = -2 Query: 415 SPPD---GSPASPTTPSVTGSKTVPSSATTSNGSATKMNLLQLVAVF--FVSASYATSAA 251 SPP+ GSP SP +PS+TGSKTVPS+ TSNGS + +NLLQL F FV+ASYA S+A Sbjct: 124 SPPESENGSPDSPISPSLTGSKTVPSNGATSNGSTSNINLLQLATNFIVFVTASYA-SSA 182 Query: 250 FNNI 239 FNNI Sbjct: 183 FNNI 186 >gb|PIN22564.1| hypothetical protein CDL12_04717 [Handroanthus impetiginosus] Length = 182 Score = 65.1 bits (157), Expect = 3e-10 Identities = 40/69 (57%), Positives = 49/69 (71%), Gaps = 10/69 (14%) Frame = -2 Query: 415 SPPDGSPAS--------PTTPSVTGSKTVPSSATTSNGSATKMNLLQLVA--VFFVSASY 266 SP D S A+ P +PSVTGSKTVPSS+TTSNGS +M+LLQLVA + F++ASY Sbjct: 114 SPVDSSEAAAPGSGDGIPGSPSVTGSKTVPSSSTTSNGSTKRMDLLQLVANIILFITASY 173 Query: 265 ATSAAFNNI 239 A A F+NI Sbjct: 174 AL-ADFSNI 181 >ref|XP_020552772.1| non-specific lipid-transfer protein-like protein At2g13820 isoform X2 [Sesamum indicum] Length = 171 Score = 62.8 bits (151), Expect = 2e-09 Identities = 38/65 (58%), Positives = 46/65 (70%), Gaps = 5/65 (7%) Frame = -2 Query: 415 SPP---DGSPASPTTPSVTGSKTVPSSATTSNGSATKMNLLQLV--AVFFVSASYATSAA 251 +PP DG P++PTTPSVTGSKT PSS TTSN S TKMN+L + F + SYA AA Sbjct: 109 APPESGDGIPSAPTTPSVTGSKTTPSSGTTSNRS-TKMNVLGVFTNVFLFTTVSYA-FAA 166 Query: 250 FNNII 236 FNN++ Sbjct: 167 FNNVL 171 >ref|XP_011091038.2| non-specific lipid-transfer protein-like protein At2g13820 isoform X1 [Sesamum indicum] Length = 184 Score = 62.8 bits (151), Expect = 2e-09 Identities = 38/65 (58%), Positives = 46/65 (70%), Gaps = 5/65 (7%) Frame = -2 Query: 415 SPP---DGSPASPTTPSVTGSKTVPSSATTSNGSATKMNLLQLV--AVFFVSASYATSAA 251 +PP DG P++PTTPSVTGSKT PSS TTSN S TKMN+L + F + SYA AA Sbjct: 122 APPESGDGIPSAPTTPSVTGSKTTPSSGTTSNRS-TKMNVLGVFTNVFLFTTVSYA-FAA 179 Query: 250 FNNII 236 FNN++ Sbjct: 180 FNNVL 184