BLASTX nr result
ID: Rehmannia29_contig00026832
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00026832 (582 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077217.1| uncharacterized protein LOC105161275 [Sesamu... 61 1e-07 >ref|XP_011077217.1| uncharacterized protein LOC105161275 [Sesamum indicum] Length = 440 Score = 61.2 bits (147), Expect = 1e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = -1 Query: 582 ASAACGQLRNEFQKVPLLAGAEVQQSELEMAVAS 481 ASAACGQLRNEFQK+PLLA AEVQQ +LEMA+AS Sbjct: 407 ASAACGQLRNEFQKIPLLASAEVQQPQLEMAIAS 440