BLASTX nr result
ID: Rehmannia29_contig00026764
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00026764 (498 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827803.1| PREDICTED: general transcription factor IIH ... 69 2e-10 ref|XP_011089329.1| general transcription factor IIH subunit 2 [... 68 4e-10 gb|PIN00735.1| RNA polymerase II transcription initiation/nucleo... 65 5e-09 emb|CAN82988.1| hypothetical protein VITISV_011714 [Vitis vinifera] 63 6e-09 ref|XP_002284994.1| PREDICTED: general transcription factor IIH ... 63 2e-08 ref|XP_019076101.1| PREDICTED: general transcription factor IIH ... 63 2e-08 emb|CBI16283.3| unnamed protein product, partial [Vitis vinifera] 63 2e-08 gb|PKI51998.1| hypothetical protein CRG98_027650 [Punica granatum] 62 5e-08 ref|XP_015946475.1| general transcription factor IIH subunit 2 [... 62 5e-08 ref|XP_004493385.1| PREDICTED: general transcription factor IIH ... 62 5e-08 ref|XP_010032024.1| PREDICTED: general transcription factor IIH ... 62 5e-08 ref|XP_022756093.1| general transcription factor IIH subunit 2-l... 61 1e-07 ref|XP_003624959.1| general transcription factor IIH subunit 2 [... 60 1e-07 ref|XP_019437076.1| PREDICTED: general transcription factor IIH ... 60 2e-07 ref|XP_018819483.1| PREDICTED: general transcription factor IIH ... 60 2e-07 ref|XP_019259136.1| PREDICTED: general transcription factor IIH ... 60 2e-07 ref|XP_015074195.1| PREDICTED: general transcription factor IIH ... 60 2e-07 ref|XP_006363938.1| PREDICTED: general transcription factor IIH ... 60 2e-07 ref|XP_004237420.1| PREDICTED: general transcription factor IIH ... 60 2e-07 ref|XP_017416925.1| PREDICTED: general transcription factor IIH ... 60 2e-07 >ref|XP_012827803.1| PREDICTED: general transcription factor IIH subunit 2 [Erythranthe guttata] ref|XP_012827804.1| PREDICTED: general transcription factor IIH subunit 2 [Erythranthe guttata] gb|EYU18861.1| hypothetical protein MIMGU_mgv1a007041mg [Erythranthe guttata] Length = 422 Score = 68.9 bits (167), Expect = 2e-10 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGTVEG 406 LDCDIYIHESLHNCPGCESFRHSK+ GTVEG Sbjct: 392 LDCDIYIHESLHNCPGCESFRHSKSNGTVEG 422 >ref|XP_011089329.1| general transcription factor IIH subunit 2 [Sesamum indicum] ref|XP_011089330.1| general transcription factor IIH subunit 2 [Sesamum indicum] Length = 422 Score = 67.8 bits (164), Expect = 4e-10 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGTVEG 406 LDCDIYIHESLHNCPGCESFRHSK+V T EG Sbjct: 392 LDCDIYIHESLHNCPGCESFRHSKSVSTAEG 422 >gb|PIN00735.1| RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit SSL1 [Handroanthus impetiginosus] Length = 422 Score = 64.7 bits (156), Expect = 5e-09 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGTVE 409 LDCDIYIHESLHNCPGCESFRHSK V +VE Sbjct: 392 LDCDIYIHESLHNCPGCESFRHSKPVASVE 421 >emb|CAN82988.1| hypothetical protein VITISV_011714 [Vitis vinifera] Length = 199 Score = 62.8 bits (151), Expect = 6e-09 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGTVE 409 LDCDIYIHESLHNCPGCESFRHSK V E Sbjct: 169 LDCDIYIHESLHNCPGCESFRHSKIVSVTE 198 >ref|XP_002284994.1| PREDICTED: general transcription factor IIH subunit 2 isoform X2 [Vitis vinifera] ref|XP_010651135.1| PREDICTED: general transcription factor IIH subunit 2 isoform X2 [Vitis vinifera] ref|XP_010651136.1| PREDICTED: general transcription factor IIH subunit 2 isoform X2 [Vitis vinifera] Length = 433 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGTVE 409 LDCDIYIHESLHNCPGCESFRHSK V E Sbjct: 403 LDCDIYIHESLHNCPGCESFRHSKIVSVTE 432 >ref|XP_019076101.1| PREDICTED: general transcription factor IIH subunit 2 isoform X1 [Vitis vinifera] ref|XP_019076102.1| PREDICTED: general transcription factor IIH subunit 2 isoform X1 [Vitis vinifera] ref|XP_019076103.1| PREDICTED: general transcription factor IIH subunit 2 isoform X1 [Vitis vinifera] Length = 444 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGTVE 409 LDCDIYIHESLHNCPGCESFRHSK V E Sbjct: 414 LDCDIYIHESLHNCPGCESFRHSKIVSVTE 443 >emb|CBI16283.3| unnamed protein product, partial [Vitis vinifera] Length = 494 Score = 62.8 bits (151), Expect = 2e-08 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGTVE 409 LDCDIYIHESLHNCPGCESFRHSK V E Sbjct: 464 LDCDIYIHESLHNCPGCESFRHSKIVSVTE 493 >gb|PKI51998.1| hypothetical protein CRG98_027650 [Punica granatum] Length = 417 Score = 61.6 bits (148), Expect = 5e-08 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -1 Query: 495 DCDIYIHESLHNCPGCESFRHSKTVGTVE 409 DCDIYIHESLHNCPGCES RHSK+V T E Sbjct: 388 DCDIYIHESLHNCPGCESLRHSKSVNTAE 416 >ref|XP_015946475.1| general transcription factor IIH subunit 2 [Arachis duranensis] ref|XP_015946476.1| general transcription factor IIH subunit 2 [Arachis duranensis] ref|XP_015946477.1| general transcription factor IIH subunit 2 [Arachis duranensis] ref|XP_020990002.1| general transcription factor IIH subunit 2 [Arachis duranensis] ref|XP_020990003.1| general transcription factor IIH subunit 2 [Arachis duranensis] ref|XP_020990004.1| general transcription factor IIH subunit 2 [Arachis duranensis] Length = 422 Score = 61.6 bits (148), Expect = 5e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGTVE 409 LDCDIYIHESLHNCPGCESFRHS +V T + Sbjct: 393 LDCDIYIHESLHNCPGCESFRHSNSVTTAQ 422 >ref|XP_004493385.1| PREDICTED: general transcription factor IIH subunit 2 [Cicer arietinum] ref|XP_012569253.1| PREDICTED: general transcription factor IIH subunit 2 [Cicer arietinum] Length = 422 Score = 61.6 bits (148), Expect = 5e-08 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTV 421 LDCDIYIHESLHNCPGCESFRHSK+V Sbjct: 394 LDCDIYIHESLHNCPGCESFRHSKSV 419 >ref|XP_010032024.1| PREDICTED: general transcription factor IIH subunit 2 [Eucalyptus grandis] gb|KCW51408.1| hypothetical protein EUGRSUZ_J00945 [Eucalyptus grandis] Length = 423 Score = 61.6 bits (148), Expect = 5e-08 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGTVE 409 +DCDIYIHESLHNCPGCESFRH KTV + E Sbjct: 393 IDCDIYIHESLHNCPGCESFRHFKTVSSSE 422 >ref|XP_022756093.1| general transcription factor IIH subunit 2-like [Durio zibethinus] ref|XP_022756094.1| general transcription factor IIH subunit 2-like [Durio zibethinus] Length = 423 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTV 421 LDCDIYIHESLHNCPGCESFRHSK V Sbjct: 393 LDCDIYIHESLHNCPGCESFRHSKPV 418 >ref|XP_003624959.1| general transcription factor IIH subunit 2 [Medicago truncatula] gb|AES81177.1| general transcription factor IIH subunit 2 [Medicago truncatula] Length = 426 Score = 60.5 bits (145), Expect = 1e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTV 421 LDCD+YIHESLHNCPGCESFRHSK+V Sbjct: 397 LDCDMYIHESLHNCPGCESFRHSKSV 422 >ref|XP_019437076.1| PREDICTED: general transcription factor IIH subunit 2-like [Lupinus angustifolius] ref|XP_019437077.1| PREDICTED: general transcription factor IIH subunit 2-like [Lupinus angustifolius] gb|OIW15485.1| hypothetical protein TanjilG_32889 [Lupinus angustifolius] Length = 421 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/26 (92%), Positives = 26/26 (100%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTV 421 LDCDIYIHESLHNCPGCESF+HSK+V Sbjct: 392 LDCDIYIHESLHNCPGCESFQHSKSV 417 >ref|XP_018819483.1| PREDICTED: general transcription factor IIH subunit 2 [Juglans regia] Length = 423 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/25 (96%), Positives = 25/25 (100%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKT 424 LDCDIYIHESLHNCPGCESFRHSK+ Sbjct: 393 LDCDIYIHESLHNCPGCESFRHSKS 417 >ref|XP_019259136.1| PREDICTED: general transcription factor IIH subunit 2 [Nicotiana attenuata] ref|XP_019259137.1| PREDICTED: general transcription factor IIH subunit 2 [Nicotiana attenuata] gb|OIT40041.1| general transcription factor iih subunit 2 [Nicotiana attenuata] Length = 414 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGTVE 409 LDCDIYIHESLHNCPGCES R+SKT+ +E Sbjct: 385 LDCDIYIHESLHNCPGCESLRNSKTISDME 414 >ref|XP_015074195.1| PREDICTED: general transcription factor IIH subunit 2 [Solanum pennellii] Length = 414 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGTVE 409 LDCDIYIHESLHNCPGCES R+SKT+ +E Sbjct: 384 LDCDIYIHESLHNCPGCESLRNSKTISDME 413 >ref|XP_006363938.1| PREDICTED: general transcription factor IIH subunit 2-like isoform X2 [Solanum tuberosum] Length = 414 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGTVE 409 LDCDIYIHESLHNCPGCES R+SKT+ +E Sbjct: 384 LDCDIYIHESLHNCPGCESLRNSKTISDME 413 >ref|XP_004237420.1| PREDICTED: general transcription factor IIH subunit 2 isoform X1 [Solanum lycopersicum] Length = 414 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGTVE 409 LDCDIYIHESLHNCPGCES R+SKT+ +E Sbjct: 384 LDCDIYIHESLHNCPGCESLRNSKTISDME 413 >ref|XP_017416925.1| PREDICTED: general transcription factor IIH subunit 2 [Vigna angularis] gb|KOM38740.1| hypothetical protein LR48_Vigan03g212200 [Vigna angularis] dbj|BAT85112.1| hypothetical protein VIGAN_04261200 [Vigna angularis var. angularis] Length = 417 Score = 59.7 bits (143), Expect = 2e-07 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = -1 Query: 498 LDCDIYIHESLHNCPGCESFRHSKTVGT 415 LDCDIYIHESLHNCPGCES RHSK+V T Sbjct: 390 LDCDIYIHESLHNCPGCESSRHSKSVTT 417