BLASTX nr result
ID: Rehmannia29_contig00026642
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00026642 (656 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN15726.1| UDP-glucuronosyl and UDP-glucosyl transferase [Ha... 68 1e-09 ref|XP_022876450.1| anthocyanidin 3-O-glucoside 2'''-O-xylosyltr... 64 4e-08 ref|XP_011082711.1| anthocyanidin 3-O-glucoside 2'''-O-xylosyltr... 64 4e-08 ref|XP_012827669.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-... 60 6e-07 ref|XP_012847908.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-... 58 4e-06 >gb|PIN15726.1| UDP-glucuronosyl and UDP-glucosyl transferase [Handroanthus impetiginosus] Length = 456 Score = 67.8 bits (164), Expect = 1e-09 Identities = 32/49 (65%), Positives = 37/49 (75%) Frame = -2 Query: 397 SKNPFSIAFDAMYEQVEILLYSLKPNIIFYDFADWISKLAPRLPSPARC 251 +KNP +IAFDAM EQVE LL LKP+I+FYDFADWI KLA R+ C Sbjct: 88 AKNPLAIAFDAMSEQVETLLCDLKPDIVFYDFADWIPKLAARIGFKTVC 136 >ref|XP_022876450.1| anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like [Olea europaea var. sylvestris] Length = 456 Score = 63.5 bits (153), Expect = 4e-08 Identities = 28/48 (58%), Positives = 35/48 (72%) Frame = -2 Query: 394 KNPFSIAFDAMYEQVEILLYSLKPNIIFYDFADWISKLAPRLPSPARC 251 KNP +IAFD+M EQVE+LL LKP+ +FYDFADWI KL ++ C Sbjct: 89 KNPLAIAFDSMAEQVEVLLSDLKPDFVFYDFADWIPKLGTKIGFKTIC 136 >ref|XP_011082711.1| anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like isoform X1 [Sesamum indicum] ref|XP_011082712.1| anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like isoform X3 [Sesamum indicum] ref|XP_020550275.1| anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like isoform X2 [Sesamum indicum] Length = 457 Score = 63.5 bits (153), Expect = 4e-08 Identities = 29/49 (59%), Positives = 36/49 (73%) Frame = -2 Query: 397 SKNPFSIAFDAMYEQVEILLYSLKPNIIFYDFADWISKLAPRLPSPARC 251 +KNP +IAFDA EQVE +L LKP+I+FYDFADWI K+A R+ C Sbjct: 88 AKNPLAIAFDATAEQVETILSGLKPDIVFYDFADWIPKMAARVGFKTVC 136 >ref|XP_012827669.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like [Erythranthe guttata] gb|EYU19000.1| hypothetical protein MIMGU_mgv1a021196mg [Erythranthe guttata] Length = 464 Score = 60.1 bits (144), Expect = 6e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 394 KNPFSIAFDAMYEQVEILLYSLKPNIIFYDFADWISKLA 278 KNP ++AFDAM EQVE LL SL P+I+FYDFA WI +LA Sbjct: 95 KNPLAVAFDAMSEQVEALLRSLNPDIVFYDFAHWIPRLA 133 >ref|XP_012847908.1| PREDICTED: anthocyanidin 3-O-glucoside 2'''-O-xylosyltransferase-like [Erythranthe guttata] gb|EYU44977.1| hypothetical protein MIMGU_mgv1a006277mg [Erythranthe guttata] Length = 450 Score = 57.8 bits (138), Expect = 4e-06 Identities = 25/49 (51%), Positives = 35/49 (71%) Frame = -2 Query: 397 SKNPFSIAFDAMYEQVEILLYSLKPNIIFYDFADWISKLAPRLPSPARC 251 +K+P ++AFDAM +E LL +LKP+I+FYDFADWI LA ++ C Sbjct: 82 AKDPLAVAFDAMSGDIETLLQNLKPDIVFYDFADWIPALAAKIGFKTVC 130