BLASTX nr result
ID: Rehmannia29_contig00026597
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00026597 (660 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN08660.1| hypothetical protein CDL12_18769 [Handroanthus im... 94 8e-19 ref|XP_020549057.1| putative pentatricopeptide repeat-containing... 93 2e-18 ref|XP_012843665.1| PREDICTED: pentatricopeptide repeat-containi... 92 6e-18 ref|XP_022863903.1| putative pentatricopeptide repeat-containing... 87 2e-17 gb|EEF29603.1| pentatricopeptide repeat-containing protein, puta... 85 2e-15 ref|XP_015583103.1| PREDICTED: putative pentatricopeptide repeat... 83 9e-15 dbj|GAV61044.1| PPR domain-containing protein/PPR_1 domain-conta... 83 1e-14 ref|XP_023883554.1| putative pentatricopeptide repeat-containing... 82 2e-14 gb|EPS66616.1| hypothetical protein M569_08159, partial [Genlise... 82 2e-14 ref|XP_017622859.1| PREDICTED: putative pentatricopeptide repeat... 82 2e-14 ref|XP_016722626.1| PREDICTED: putative pentatricopeptide repeat... 82 2e-14 ref|XP_002308767.2| hypothetical protein POPTR_0006s00830g, part... 81 3e-14 ref|XP_020990967.1| putative pentatricopeptide repeat-containing... 76 3e-14 ref|XP_022773088.1| putative pentatricopeptide repeat-containing... 80 6e-14 ref|XP_022773087.1| putative pentatricopeptide repeat-containing... 80 6e-14 ref|XP_022773086.1| putative pentatricopeptide repeat-containing... 80 7e-14 ref|XP_015080687.1| PREDICTED: putative pentatricopeptide repeat... 80 8e-14 ref|XP_006348886.1| PREDICTED: putative pentatricopeptide repeat... 80 8e-14 ref|XP_004243786.1| PREDICTED: putative pentatricopeptide repeat... 80 8e-14 ref|XP_018857088.1| PREDICTED: putative pentatricopeptide repeat... 80 1e-13 >gb|PIN08660.1| hypothetical protein CDL12_18769 [Handroanthus impetiginosus] Length = 441 Score = 94.4 bits (233), Expect = 8e-19 Identities = 48/50 (96%), Positives = 50/50 (100%) Frame = +2 Query: 509 MFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLIT 658 MFLRLST+LLNISIASLCRAKQLEKAEAA+IDGIRLGVLPDVVTYNTLIT Sbjct: 1 MFLRLSTKLLNISIASLCRAKQLEKAEAAMIDGIRLGVLPDVVTYNTLIT 50 >ref|XP_020549057.1| putative pentatricopeptide repeat-containing protein At4g17915 [Sesamum indicum] Length = 456 Score = 93.2 bits (230), Expect = 2e-18 Identities = 48/50 (96%), Positives = 49/50 (98%) Frame = +2 Query: 509 MFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLIT 658 MFLRLST+LLNISIASLCRAKQLEKAEAAIID IRLGVLPDVVTYNTLIT Sbjct: 1 MFLRLSTKLLNISIASLCRAKQLEKAEAAIIDAIRLGVLPDVVTYNTLIT 50 >ref|XP_012843665.1| PREDICTED: pentatricopeptide repeat-containing protein At5g46680 [Erythranthe guttata] Length = 462 Score = 92.0 bits (227), Expect = 6e-18 Identities = 46/50 (92%), Positives = 50/50 (100%) Frame = +2 Query: 509 MFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLIT 658 MFLRLST+LLNISIASLCRAKQLEKAEAAI+DGI+LGVLP+VVTYNTLIT Sbjct: 1 MFLRLSTKLLNISIASLCRAKQLEKAEAAIVDGIKLGVLPNVVTYNTLIT 50 >ref|XP_022863903.1| putative pentatricopeptide repeat-containing protein At4g17915 [Olea europaea var. sylvestris] Length = 230 Score = 87.4 bits (215), Expect = 2e-17 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = +2 Query: 509 MFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLIT 658 MF RLST+LLNI+IASLCR KQLEKAE AIIDGIRLG+LPDVVTYNTL+T Sbjct: 1 MFKRLSTKLLNITIASLCRTKQLEKAETAIIDGIRLGILPDVVTYNTLMT 50 >gb|EEF29603.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 487 Score = 84.7 bits (208), Expect = 2e-15 Identities = 43/50 (86%), Positives = 46/50 (92%) Frame = +2 Query: 506 RMFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLI 655 RM RLSTRLLNISIASLC+AK+L KAE+ IIDGIRLGVLPDVVTYNTLI Sbjct: 30 RMVRRLSTRLLNISIASLCKAKELNKAESVIIDGIRLGVLPDVVTYNTLI 79 >ref|XP_015583103.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Ricinus communis] Length = 457 Score = 82.8 bits (203), Expect = 9e-15 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +2 Query: 509 MFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLI 655 M RLSTRLLNISIASLC+AK+L KAE+ IIDGIRLGVLPDVVTYNTLI Sbjct: 1 MVRRLSTRLLNISIASLCKAKELNKAESVIIDGIRLGVLPDVVTYNTLI 49 >dbj|GAV61044.1| PPR domain-containing protein/PPR_1 domain-containing protein/PPR_2 domain-containing protein [Cephalotus follicularis] Length = 465 Score = 82.8 bits (203), Expect = 1e-14 Identities = 42/57 (73%), Positives = 48/57 (84%) Frame = +2 Query: 485 LILTLMRRMFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLI 655 +++ L RRM RLSTRLLNI I S C+A +LEKAEA IIDGIRLGVLPDVVTYNTL+ Sbjct: 1 MMMELPRRMVRRLSTRLLNICIYSYCKAHRLEKAEAVIIDGIRLGVLPDVVTYNTLV 57 >ref|XP_023883554.1| putative pentatricopeptide repeat-containing protein At4g17915 [Quercus suber] ref|XP_023883555.1| putative pentatricopeptide repeat-containing protein At4g17915 [Quercus suber] ref|XP_023883556.1| putative pentatricopeptide repeat-containing protein At4g17915 [Quercus suber] Length = 456 Score = 82.0 bits (201), Expect = 2e-14 Identities = 41/49 (83%), Positives = 44/49 (89%) Frame = +2 Query: 509 MFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLI 655 M RLSTRLLNISIA C+++QLEKAEA IIDGIRLGVLPDVVTYNTLI Sbjct: 1 MVCRLSTRLLNISIAGFCKSRQLEKAEAVIIDGIRLGVLPDVVTYNTLI 49 >gb|EPS66616.1| hypothetical protein M569_08159, partial [Genlisea aurea] Length = 451 Score = 81.6 bits (200), Expect = 2e-14 Identities = 41/49 (83%), Positives = 46/49 (93%) Frame = +2 Query: 509 MFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLI 655 M LRLST+LLNIS+ASLCRAKQ+EKAEAAIID I LG+LP+VVTYNTLI Sbjct: 1 MPLRLSTKLLNISVASLCRAKQMEKAEAAIIDAISLGILPNVVTYNTLI 49 >ref|XP_017622859.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Gossypium arboreum] Length = 468 Score = 81.6 bits (200), Expect = 2e-14 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = +2 Query: 503 RRMFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLI 655 RRM R STRLLN+ IASLC+A +LEKAE+ IIDGIRLGVLPDVVTYNTLI Sbjct: 11 RRMVHRFSTRLLNVCIASLCKAHKLEKAESVIIDGIRLGVLPDVVTYNTLI 61 >ref|XP_016722626.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Gossypium hirsutum] ref|XP_016722632.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Gossypium hirsutum] ref|XP_016722637.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Gossypium hirsutum] ref|XP_016722643.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Gossypium hirsutum] Length = 468 Score = 81.6 bits (200), Expect = 2e-14 Identities = 41/51 (80%), Positives = 45/51 (88%) Frame = +2 Query: 503 RRMFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLI 655 RRM R STRLLN+ IASLC+A +LEKAE+ IIDGIRLGVLPDVVTYNTLI Sbjct: 11 RRMVHRFSTRLLNVCIASLCKAHKLEKAESVIIDGIRLGVLPDVVTYNTLI 61 >ref|XP_002308767.2| hypothetical protein POPTR_0006s00830g, partial [Populus trichocarpa] Length = 342 Score = 80.9 bits (198), Expect = 3e-14 Identities = 39/57 (68%), Positives = 46/57 (80%) Frame = +2 Query: 485 LILTLMRRMFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLI 655 L+L R+F+R STR LNI IAS C+AK L++AE IIDG+RLGVLPDVVTYNTLI Sbjct: 14 LLLVCKSRLFVRSSTRFLNICIASFCKAKHLQRAETVIIDGVRLGVLPDVVTYNTLI 70 >ref|XP_020990967.1| putative pentatricopeptide repeat-containing protein At4g17915 [Arachis duranensis] Length = 118 Score = 76.3 bits (186), Expect = 3e-14 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +2 Query: 509 MFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLI 655 M RLST++LNI IAS+C+AKQ+ KAEA II+G+RLGVLPDVVTYNTLI Sbjct: 1 MVARLSTKVLNICIASMCKAKQVVKAEAVIINGVRLGVLPDVVTYNTLI 49 >ref|XP_022773088.1| putative pentatricopeptide repeat-containing protein At4g17915 isoform X3 [Durio zibethinus] Length = 463 Score = 80.5 bits (197), Expect = 6e-14 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = +2 Query: 503 RRMFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLI 655 RRM RLSTRLLN+ +ASLC+A +LEKAE IIDGIRLGVLPDVVTYN LI Sbjct: 5 RRMVRRLSTRLLNVCVASLCKAHKLEKAETVIIDGIRLGVLPDVVTYNCLI 55 >ref|XP_022773087.1| putative pentatricopeptide repeat-containing protein At4g17915 isoform X2 [Durio zibethinus] Length = 471 Score = 80.5 bits (197), Expect = 6e-14 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = +2 Query: 503 RRMFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLI 655 RRM RLSTRLLN+ +ASLC+A +LEKAE IIDGIRLGVLPDVVTYN LI Sbjct: 5 RRMVRRLSTRLLNVCVASLCKAHKLEKAETVIIDGIRLGVLPDVVTYNCLI 55 >ref|XP_022773086.1| putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Durio zibethinus] Length = 506 Score = 80.5 bits (197), Expect = 7e-14 Identities = 40/51 (78%), Positives = 44/51 (86%) Frame = +2 Query: 503 RRMFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLI 655 RRM RLSTRLLN+ +ASLC+A +LEKAE IIDGIRLGVLPDVVTYN LI Sbjct: 5 RRMVRRLSTRLLNVCVASLCKAHKLEKAETVIIDGIRLGVLPDVVTYNCLI 55 >ref|XP_015080687.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum pennellii] ref|XP_015080688.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum pennellii] ref|XP_015080689.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum pennellii] ref|XP_015080690.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum pennellii] ref|XP_015080691.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum pennellii] ref|XP_015080692.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum pennellii] ref|XP_015080693.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum pennellii] Length = 460 Score = 80.1 bits (196), Expect = 8e-14 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 518 RLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLIT 658 RLSTRL+NI +ASLC+AKQLEKAE I+DGIR+GV PDVVTYNTLIT Sbjct: 7 RLSTRLMNICVASLCKAKQLEKAEVVIVDGIRIGVQPDVVTYNTLIT 53 >ref|XP_006348886.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Solanum tuberosum] ref|XP_015164876.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Solanum tuberosum] ref|XP_015164877.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Solanum tuberosum] ref|XP_015164878.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Solanum tuberosum] Length = 460 Score = 80.1 bits (196), Expect = 8e-14 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 518 RLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLIT 658 RLSTRL+NI +ASLC+AKQLEKAE I+DGIR+GV PDVVTYNTLIT Sbjct: 7 RLSTRLMNICVASLCKAKQLEKAEVVIVDGIRIGVQPDVVTYNTLIT 53 >ref|XP_004243786.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum lycopersicum] ref|XP_010323676.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum lycopersicum] ref|XP_010323677.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum lycopersicum] ref|XP_010323678.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum lycopersicum] ref|XP_010323679.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 isoform X1 [Solanum lycopersicum] Length = 460 Score = 80.1 bits (196), Expect = 8e-14 Identities = 38/47 (80%), Positives = 43/47 (91%) Frame = +2 Query: 518 RLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLIT 658 RLSTRL+NI +ASLC+AKQLEKAE I+DGIR+GV PDVVTYNTLIT Sbjct: 7 RLSTRLMNICVASLCKAKQLEKAEVVIVDGIRIGVQPDVVTYNTLIT 53 >ref|XP_018857088.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Juglans regia] ref|XP_018857094.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Juglans regia] ref|XP_018857100.1| PREDICTED: putative pentatricopeptide repeat-containing protein At4g17915 [Juglans regia] Length = 456 Score = 79.7 bits (195), Expect = 1e-13 Identities = 40/49 (81%), Positives = 42/49 (85%) Frame = +2 Query: 509 MFLRLSTRLLNISIASLCRAKQLEKAEAAIIDGIRLGVLPDVVTYNTLI 655 M RLSTRLLNI IAS C+ KQLE+AE IIDGIRLGVLPDVVTYNTLI Sbjct: 1 MSFRLSTRLLNICIASFCKTKQLERAEVVIIDGIRLGVLPDVVTYNTLI 49