BLASTX nr result
ID: Rehmannia29_contig00026569
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00026569 (523 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN21136.1| hypothetical protein CDL12_06175 [Handroanthus im... 57 4e-06 >gb|PIN21136.1| hypothetical protein CDL12_06175 [Handroanthus impetiginosus] Length = 1063 Score = 56.6 bits (135), Expect = 4e-06 Identities = 28/51 (54%), Positives = 37/51 (72%), Gaps = 1/51 (1%) Frame = -3 Query: 152 NMISSIAPSWALFGLLILLCTDFANSYY-KNGDFEVSRSKHSTSYNYDRIS 3 N++S IA +W FGLL+++C ANSYY NG+FE KHS SY+Y+RIS Sbjct: 2 NLMSYIAETWTPFGLLMMICIGIANSYYVNNGNFE----KHSVSYSYERIS 48