BLASTX nr result
ID: Rehmannia29_contig00025981
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00025981 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN21402.1| hypothetical protein CDL12_05875 [Handroanthus im... 61 4e-08 ref|XP_020550998.1| LOW QUALITY PROTEIN: metal-nicotianamine tra... 59 2e-07 ref|XP_022887000.1| metal-nicotianamine transporter YSL3-like [O... 58 4e-07 gb|PIN16546.1| hypothetical protein CDL12_10803 [Handroanthus im... 58 5e-07 ref|XP_016445309.1| PREDICTED: metal-nicotianamine transporter Y... 58 5e-07 ref|XP_019246847.1| PREDICTED: metal-nicotianamine transporter Y... 58 5e-07 ref|XP_019246846.1| PREDICTED: metal-nicotianamine transporter Y... 58 5e-07 ref|XP_016445308.1| PREDICTED: metal-nicotianamine transporter Y... 58 5e-07 ref|XP_019246845.1| PREDICTED: metal-nicotianamine transporter Y... 58 5e-07 ref|XP_016445307.1| PREDICTED: metal-nicotianamine transporter Y... 58 5e-07 gb|KZV17217.1| hypothetical protein F511_04018 [Dorcoceras hygro... 57 7e-07 ref|XP_019195404.1| PREDICTED: metal-nicotianamine transporter Y... 57 7e-07 ref|XP_019195402.1| PREDICTED: metal-nicotianamine transporter Y... 57 7e-07 ref|XP_011075924.1| LOW QUALITY PROTEIN: metal-nicotianamine tra... 56 2e-06 ref|XP_009763791.1| PREDICTED: metal-nicotianamine transporter Y... 56 3e-06 ref|XP_009763790.1| PREDICTED: metal-nicotianamine transporter Y... 56 3e-06 ref|XP_012843254.1| PREDICTED: metal-nicotianamine transporter Y... 56 3e-06 ref|XP_009763789.1| PREDICTED: metal-nicotianamine transporter Y... 56 3e-06 dbj|BAV57584.1| probable YSL-transporter [Olea europaea] 56 3e-06 ref|XP_019229058.1| PREDICTED: metal-nicotianamine transporter Y... 55 5e-06 >gb|PIN21402.1| hypothetical protein CDL12_05875 [Handroanthus impetiginosus] Length = 488 Score = 60.8 bits (146), Expect = 4e-08 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFL+TL FTARSM+AAF K Sbjct: 140 KVFISIALILGDGLYNFLKTLIFTARSMYAAFNK 173 >ref|XP_020550998.1| LOW QUALITY PROTEIN: metal-nicotianamine transporter YSL3 [Sesamum indicum] Length = 655 Score = 58.9 bits (141), Expect = 2e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFL+TLFFT RSM++ F K Sbjct: 308 KVFISIALILGDGLYNFLKTLFFTVRSMYSTFNK 341 >ref|XP_022887000.1| metal-nicotianamine transporter YSL3-like [Olea europaea var. sylvestris] Length = 670 Score = 58.2 bits (139), Expect = 4e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNF++TLF T+RSM+ AFKK Sbjct: 319 KVFISIALILGDGLYNFVKTLFLTSRSMYDAFKK 352 >gb|PIN16546.1| hypothetical protein CDL12_10803 [Handroanthus impetiginosus] Length = 406 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFL+TL FT RSM++AF K Sbjct: 57 KVFISIALILGDGLYNFLKTLLFTMRSMYSAFNK 90 >ref|XP_016445309.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X3 [Nicotiana tabacum] Length = 636 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFL+TLFFT RS++AA K Sbjct: 319 KVFISIALILGDGLYNFLKTLFFTGRSIYAALNK 352 >ref|XP_019246847.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X3 [Nicotiana attenuata] Length = 657 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFL+TLFFT RS++AA K Sbjct: 307 KVFISIALILGDGLYNFLKTLFFTGRSIYAALNK 340 >ref|XP_019246846.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X2 [Nicotiana attenuata] Length = 662 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFL+TLFFT RS++AA K Sbjct: 313 KVFISIALILGDGLYNFLKTLFFTGRSIYAALNK 346 >ref|XP_016445308.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X2 [Nicotiana tabacum] Length = 662 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFL+TLFFT RS++AA K Sbjct: 313 KVFISIALILGDGLYNFLKTLFFTGRSIYAALNK 346 >ref|XP_019246845.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X1 [Nicotiana attenuata] gb|OIT01618.1| metal-nicotianamine transporter ysl3 [Nicotiana attenuata] Length = 663 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFL+TLFFT RS++AA K Sbjct: 313 KVFISIALILGDGLYNFLKTLFFTGRSIYAALNK 346 >ref|XP_016445307.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X1 [Nicotiana tabacum] Length = 668 Score = 57.8 bits (138), Expect = 5e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFL+TLFFT RS++AA K Sbjct: 319 KVFISIALILGDGLYNFLKTLFFTGRSIYAALNK 352 >gb|KZV17217.1| hypothetical protein F511_04018 [Dorcoceras hygrometricum] Length = 616 Score = 57.4 bits (137), Expect = 7e-07 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFL+TL T RSM AAFKK Sbjct: 318 KVFISIALILGDGLYNFLKTLLLTVRSMHAAFKK 351 >ref|XP_019195404.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X2 [Ipomoea nil] Length = 668 Score = 57.4 bits (137), Expect = 7e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFLRTLF+T+R +FAA K Sbjct: 319 KVFISIALILGDGLYNFLRTLFYTSRRIFAAMNK 352 >ref|XP_019195402.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X1 [Ipomoea nil] ref|XP_019195403.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X1 [Ipomoea nil] Length = 669 Score = 57.4 bits (137), Expect = 7e-07 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFLRTLF+T+R +FAA K Sbjct: 319 KVFISIALILGDGLYNFLRTLFYTSRRIFAAMNK 352 >ref|XP_011075924.1| LOW QUALITY PROTEIN: metal-nicotianamine transporter YSL3 [Sesamum indicum] Length = 664 Score = 56.2 bits (134), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNF+RT+ FT RSM+ AF K Sbjct: 315 KVFISIALILGDGLYNFIRTILFTIRSMYYAFNK 348 >ref|XP_009763791.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X3 [Nicotiana sylvestris] Length = 636 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFL+TLFFT R ++AA K Sbjct: 319 KVFISIALILGDGLYNFLKTLFFTGRRIYAALNK 352 >ref|XP_009763790.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X2 [Nicotiana sylvestris] Length = 662 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFL+TLFFT R ++AA K Sbjct: 313 KVFISIALILGDGLYNFLKTLFFTGRRIYAALNK 346 >ref|XP_012843254.1| PREDICTED: metal-nicotianamine transporter YSL2-like [Erythranthe guttata] ref|XP_012843262.1| PREDICTED: metal-nicotianamine transporter YSL2-like [Erythranthe guttata] gb|EYU45295.1| hypothetical protein MIMGU_mgv1a002502mg [Erythranthe guttata] Length = 666 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 ++FISIALILGDGLYNF +TL+FT RSM +AFKK Sbjct: 318 RIFISIALILGDGLYNFCKTLWFTFRSMHSAFKK 351 >ref|XP_009763789.1| PREDICTED: metal-nicotianamine transporter YSL3-like isoform X1 [Nicotiana sylvestris] Length = 668 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFKK 406 +VFISIALILGDGLYNFL+TLFFT R ++AA K Sbjct: 319 KVFISIALILGDGLYNFLKTLFFTGRRIYAALNK 352 >dbj|BAV57584.1| probable YSL-transporter [Olea europaea] Length = 669 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFK 403 +VFISIALILGDGLYNF++TL T RSM+AAFK Sbjct: 318 KVFISIALILGDGLYNFVKTLILTTRSMYAAFK 350 >ref|XP_019229058.1| PREDICTED: metal-nicotianamine transporter YSL2-like isoform X2 [Nicotiana attenuata] Length = 513 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/33 (75%), Positives = 30/33 (90%) Frame = +2 Query: 305 QVFISIALILGDGLYNFLRTLFFTARSMFAAFK 403 +VFISIALILGDGLYNF+RTLFFT RS++ + K Sbjct: 162 KVFISIALILGDGLYNFVRTLFFTGRSIYVSLK 194