BLASTX nr result
ID: Rehmannia29_contig00025830
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00025830 (576 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012854608.1| PREDICTED: telomere length regulation protei... 79 1e-13 ref|XP_011072973.1| telomere length regulation protein TEL2 homo... 69 4e-10 ref|XP_011072972.1| telomere length regulation protein TEL2 homo... 69 4e-10 ref|XP_022850511.1| uncharacterized protein LOC111372399 [Olea e... 63 3e-08 >ref|XP_012854608.1| PREDICTED: telomere length regulation protein TEL2 homolog [Erythranthe guttata] gb|EYU23160.1| hypothetical protein MIMGU_mgv1a000694mg [Erythranthe guttata] Length = 1015 Score = 79.0 bits (193), Expect = 1e-13 Identities = 43/69 (62%), Positives = 49/69 (71%) Frame = +2 Query: 368 SGSGRCSQLIPHNFHRGLFYSLLDISSLFFKRLTTQLLHGVEEWDLRLVDKSAVANDIHM 547 SG + IP RG SL + LFFKRL TQLLHG EEWDL+LVDKSA AN+IHM Sbjct: 197 SGVSQLITSIPDKARRGSPPSLS--AHLFFKRLATQLLHGAEEWDLKLVDKSAGANEIHM 254 Query: 548 DGSILFVGE 574 DG+ILFVG+ Sbjct: 255 DGTILFVGQ 263 >ref|XP_011072973.1| telomere length regulation protein TEL2 homolog isoform X2 [Sesamum indicum] Length = 901 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +2 Query: 443 SSLFFKRLTTQLLHGVEEWDLRLVDKSAVANDIHMDGSILFVGE 574 S LFF+RLTTQLL G EEWD+ LVD++A A D HMDGSI FVGE Sbjct: 218 SHLFFERLTTQLLQGAEEWDMMLVDETAAAEDTHMDGSIRFVGE 261 >ref|XP_011072972.1| telomere length regulation protein TEL2 homolog isoform X1 [Sesamum indicum] Length = 1015 Score = 68.9 bits (167), Expect = 4e-10 Identities = 32/44 (72%), Positives = 36/44 (81%) Frame = +2 Query: 443 SSLFFKRLTTQLLHGVEEWDLRLVDKSAVANDIHMDGSILFVGE 574 S LFF+RLTTQLL G EEWD+ LVD++A A D HMDGSI FVGE Sbjct: 218 SHLFFERLTTQLLQGAEEWDMMLVDETAAAEDTHMDGSIRFVGE 261 >ref|XP_022850511.1| uncharacterized protein LOC111372399 [Olea europaea var. sylvestris] Length = 402 Score = 63.2 bits (152), Expect = 3e-08 Identities = 33/60 (55%), Positives = 41/60 (68%) Frame = +2 Query: 395 IPHNFHRGLFYSLLDISSLFFKRLTTQLLHGVEEWDLRLVDKSAVANDIHMDGSILFVGE 574 IP RG SL LFFKR+T QLL+G+EE D+ L+DK NDI+MDG++LFVGE Sbjct: 207 IPDKARRGAPISLSP--HLFFKRITAQLLNGIEECDMNLIDKRDTFNDINMDGAVLFVGE 264