BLASTX nr result
ID: Rehmannia29_contig00025792
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00025792 (908 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_023963416.1| beta/gamma crystallin domain-containing prot... 60 3e-06 ref|XP_023963415.1| beta/gamma crystallin domain-containing prot... 60 3e-06 ref|XP_005302264.2| beta/gamma crystallin domain-containing prot... 60 3e-06 >ref|XP_023963416.1| beta/gamma crystallin domain-containing protein 2 isoform X3 [Chrysemys picta bellii] Length = 1490 Score = 60.1 bits (144), Expect = 3e-06 Identities = 33/72 (45%), Positives = 49/72 (68%) Frame = +3 Query: 231 VSVGGVTTPSGTPQYSDIPPSVAYGVTTPSGTPQYSDVPASVAFGVTTPLASLQASHGSA 410 +S G TTP+G+P+ S +P +V G+TTP G+P+ + VP+ A G TP+ S + SHG Sbjct: 190 LSAGSTTTPTGSPRESHMPSAV--GITTPVGSPKANHVPS--AIGTNTPICSPRKSHG-P 244 Query: 411 SAVGVTSVLTLQ 446 SAVG+T+V + Q Sbjct: 245 SAVGITTVTSSQ 256 >ref|XP_023963415.1| beta/gamma crystallin domain-containing protein 2 isoform X2 [Chrysemys picta bellii] Length = 1807 Score = 60.1 bits (144), Expect = 3e-06 Identities = 33/72 (45%), Positives = 49/72 (68%) Frame = +3 Query: 231 VSVGGVTTPSGTPQYSDIPPSVAYGVTTPSGTPQYSDVPASVAFGVTTPLASLQASHGSA 410 +S G TTP+G+P+ S +P +V G+TTP G+P+ + VP+ A G TP+ S + SHG Sbjct: 516 LSAGSTTTPTGSPRESHMPSAV--GITTPVGSPKANHVPS--AIGTNTPICSPRKSHG-P 570 Query: 411 SAVGVTSVLTLQ 446 SAVG+T+V + Q Sbjct: 571 SAVGITTVTSSQ 582 >ref|XP_005302264.2| beta/gamma crystallin domain-containing protein 2 isoform X1 [Chrysemys picta bellii] Length = 1816 Score = 60.1 bits (144), Expect = 3e-06 Identities = 33/72 (45%), Positives = 49/72 (68%) Frame = +3 Query: 231 VSVGGVTTPSGTPQYSDIPPSVAYGVTTPSGTPQYSDVPASVAFGVTTPLASLQASHGSA 410 +S G TTP+G+P+ S +P +V G+TTP G+P+ + VP+ A G TP+ S + SHG Sbjct: 516 LSAGSTTTPTGSPRESHMPSAV--GITTPVGSPKANHVPS--AIGTNTPICSPRKSHG-P 570 Query: 411 SAVGVTSVLTLQ 446 SAVG+T+V + Q Sbjct: 571 SAVGITTVTSSQ 582