BLASTX nr result
ID: Rehmannia29_contig00025718
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00025718 (720 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099289.2| F-box/LRR-repeat protein At3g26922-like [Ses... 74 2e-11 >ref|XP_011099289.2| F-box/LRR-repeat protein At3g26922-like [Sesamum indicum] Length = 427 Score = 73.6 bits (179), Expect = 2e-11 Identities = 37/50 (74%), Positives = 42/50 (84%) Frame = +2 Query: 2 PSPFPYMKCLKLTKRRQIIHPTLMETVPQTVMNYLTKGHSAYGDSLVVEF 151 PSPFPY+KCLKLTKR IIHP M+ VPQTV+NYLTK S+Y DSLVV+F Sbjct: 364 PSPFPYIKCLKLTKRHNIIHP--MKAVPQTVINYLTK-ESSYSDSLVVKF 410