BLASTX nr result
ID: Rehmannia29_contig00025704
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00025704 (379 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|POF02745.1| hypothetical protein CFP56_04978 [Quercus suber] 59 1e-07 >gb|POF02745.1| hypothetical protein CFP56_04978 [Quercus suber] Length = 367 Score = 58.9 bits (141), Expect = 1e-07 Identities = 29/53 (54%), Positives = 37/53 (69%), Gaps = 5/53 (9%) Frame = -3 Query: 287 EVVGQIKGCLSDIMVRYVPGIKHEPLNQGMSFDQTWKALPTH-----CLTQEV 144 ++VGQ+KGCL IM RY+P + PL QGMS+ TWK+LPT+ CL QEV Sbjct: 195 KMVGQLKGCLPTIMNRYLPRLSKIPLCQGMSWTSTWKSLPTYKQMTECLRQEV 247