BLASTX nr result
ID: Rehmannia29_contig00025639
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00025639 (487 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_017985129.1| PREDICTED: nodal modulator 1 isoform X2 [The... 59 3e-07 gb|AIU49953.1| carbohydrate-binding-like fold protein, partial [... 59 3e-07 gb|AIU49941.1| carbohydrate-binding-like fold protein, partial [... 59 3e-07 gb|AIU49962.1| carbohydrate-binding-like fold protein, partial [... 59 3e-07 ref|XP_012827376.1| PREDICTED: nodal modulator 1-like, partial [... 59 4e-07 ref|XP_012835914.1| PREDICTED: nodal modulator 1-like [Erythrant... 59 4e-07 ref|XP_022953810.1| nodal modulator 1-like [Cucurbita moschata] 59 4e-07 ref|XP_021279934.1| nodal modulator 1 [Herrania umbratica] 59 4e-07 ref|XP_017985122.1| PREDICTED: nodal modulator 1 isoform X1 [The... 59 4e-07 gb|EOX95297.1| Carbohydrate-binding-like fold [Theobroma cacao] 59 4e-07 gb|AIU49949.1| carbohydrate-binding-like fold protein, partial [... 58 9e-07 gb|AIU49976.1| carbohydrate-binding-like fold protein, partial [... 58 9e-07 gb|AIU49943.1| carbohydrate-binding-like fold protein, partial [... 58 9e-07 ref|XP_010069828.1| PREDICTED: nodal modulator 1 [Eucalyptus gra... 58 9e-07 ref|XP_002271147.1| PREDICTED: nodal modulator 1 [Vitis vinifera... 58 9e-07 gb|AIU49937.1| carbohydrate-binding-like fold protein, partial [... 58 1e-06 ref|XP_022770794.1| nodal modulator 1 isoform X2 [Durio zibethinus] 58 1e-06 ref|XP_022770793.1| nodal modulator 1 isoform X1 [Durio zibethinus] 58 1e-06 ref|XP_023547931.1| nodal modulator 1-like [Cucurbita pepo subsp... 58 1e-06 ref|XP_022991547.1| nodal modulator 1-like [Cucurbita maxima] 58 1e-06 >ref|XP_017985129.1| PREDICTED: nodal modulator 1 isoform X2 [Theobroma cacao] Length = 1020 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVKQTDESGNFCFEV Sbjct: 422 VALTHGPENVKPQVKQTDESGNFCFEV 448 >gb|AIU49953.1| carbohydrate-binding-like fold protein, partial [Chloranthus japonicus] Length = 1040 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVKQTDESGNFCFEV Sbjct: 363 VALTHGPENVKPQVKQTDESGNFCFEV 389 >gb|AIU49941.1| carbohydrate-binding-like fold protein, partial [Theobroma cacao] Length = 1040 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVKQTDESGNFCFEV Sbjct: 363 VALTHGPENVKPQVKQTDESGNFCFEV 389 >gb|AIU49962.1| carbohydrate-binding-like fold protein, partial [Erythranthe guttata] Length = 1041 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVKQTDESGNFCFEV Sbjct: 363 VALTHGPENVKPQVKQTDESGNFCFEV 389 >ref|XP_012827376.1| PREDICTED: nodal modulator 1-like, partial [Erythranthe guttata] Length = 1098 Score = 59.3 bits (142), Expect = 4e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVKQTDESGNFCFEV Sbjct: 420 VALTHGPENVKPQVKQTDESGNFCFEV 446 >ref|XP_012835914.1| PREDICTED: nodal modulator 1-like [Erythranthe guttata] gb|EYU38423.1| hypothetical protein MIMGU_mgv1a000387mg [Erythranthe guttata] Length = 1195 Score = 59.3 bits (142), Expect = 4e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVKQTDESGNFCFEV Sbjct: 424 VALTHGPENVKPQVKQTDESGNFCFEV 450 >ref|XP_022953810.1| nodal modulator 1-like [Cucurbita moschata] Length = 1197 Score = 59.3 bits (142), Expect = 4e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVKQTDESGNFCFEV Sbjct: 422 VALTHGPENVKPQVKQTDESGNFCFEV 448 >ref|XP_021279934.1| nodal modulator 1 [Herrania umbratica] Length = 1197 Score = 59.3 bits (142), Expect = 4e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVKQTDESGNFCFEV Sbjct: 422 VALTHGPENVKPQVKQTDESGNFCFEV 448 >ref|XP_017985122.1| PREDICTED: nodal modulator 1 isoform X1 [Theobroma cacao] Length = 1197 Score = 59.3 bits (142), Expect = 4e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVKQTDESGNFCFEV Sbjct: 422 VALTHGPENVKPQVKQTDESGNFCFEV 448 >gb|EOX95297.1| Carbohydrate-binding-like fold [Theobroma cacao] Length = 1197 Score = 59.3 bits (142), Expect = 4e-07 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVKQTDESGNFCFEV Sbjct: 422 VALTHGPENVKPQVKQTDESGNFCFEV 448 >gb|AIU49949.1| carbohydrate-binding-like fold protein, partial [Eucalyptus grandis] Length = 1039 Score = 58.2 bits (139), Expect = 9e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQ+KQTDESGNFCFEV Sbjct: 363 VALTHGPENVKPQMKQTDESGNFCFEV 389 >gb|AIU49976.1| carbohydrate-binding-like fold protein, partial [Vitis vinifera] Length = 1040 Score = 58.2 bits (139), Expect = 9e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVKQTDE+GNFCFEV Sbjct: 363 VALTHGPENVKPQVKQTDETGNFCFEV 389 >gb|AIU49943.1| carbohydrate-binding-like fold protein, partial [Sarcandra glabra] Length = 1040 Score = 58.2 bits (139), Expect = 9e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVKQTDE+GNFCFEV Sbjct: 363 VALTHGPENVKPQVKQTDENGNFCFEV 389 >ref|XP_010069828.1| PREDICTED: nodal modulator 1 [Eucalyptus grandis] gb|KCW58310.1| hypothetical protein EUGRSUZ_H00999 [Eucalyptus grandis] Length = 1199 Score = 58.2 bits (139), Expect = 9e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQ+KQTDESGNFCFEV Sbjct: 427 VALTHGPENVKPQMKQTDESGNFCFEV 453 >ref|XP_002271147.1| PREDICTED: nodal modulator 1 [Vitis vinifera] emb|CBI36965.3| unnamed protein product, partial [Vitis vinifera] Length = 1199 Score = 58.2 bits (139), Expect = 9e-07 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVKQTDE+GNFCFEV Sbjct: 422 VALTHGPENVKPQVKQTDETGNFCFEV 448 >gb|AIU49937.1| carbohydrate-binding-like fold protein, partial [Magnolia denudata] Length = 1040 Score = 57.8 bits (138), Expect = 1e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = +3 Query: 180 SSECHVALTHGPKNVKPQVKQTDESGNFCFEV 275 S + VALTHGP+NVKPQVKQTDESG FCFEV Sbjct: 358 SIKAKVALTHGPENVKPQVKQTDESGRFCFEV 389 >ref|XP_022770794.1| nodal modulator 1 isoform X2 [Durio zibethinus] Length = 1082 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVK+TDESGNFCFEV Sbjct: 308 VALTHGPENVKPQVKRTDESGNFCFEV 334 >ref|XP_022770793.1| nodal modulator 1 isoform X1 [Durio zibethinus] Length = 1196 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NVKPQVK+TDESGNFCFEV Sbjct: 422 VALTHGPENVKPQVKRTDESGNFCFEV 448 >ref|XP_023547931.1| nodal modulator 1-like [Cucurbita pepo subsp. pepo] Length = 1197 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NV+PQVKQTDESGNFCFEV Sbjct: 422 VALTHGPENVEPQVKQTDESGNFCFEV 448 >ref|XP_022991547.1| nodal modulator 1-like [Cucurbita maxima] Length = 1197 Score = 57.8 bits (138), Expect = 1e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = +3 Query: 195 VALTHGPKNVKPQVKQTDESGNFCFEV 275 VALTHGP+NV+PQVKQTDESGNFCFEV Sbjct: 422 VALTHGPENVEPQVKQTDESGNFCFEV 448