BLASTX nr result
ID: Rehmannia29_contig00025607
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00025607 (408 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011097618.1| alanine--glyoxylate aminotransferase 2 homol... 98 3e-21 ref|XP_012853518.1| PREDICTED: alanine--glyoxylate aminotransfer... 86 5e-17 gb|PIN03022.1| Alanine-glyoxylate aminotransferase AGT2 [Handroa... 83 9e-16 gb|KZV35656.1| alanine--glyoxylate aminotransferase 21, mitochon... 66 6e-10 ref|XP_011090577.1| alanine--glyoxylate aminotransferase 2 homol... 64 4e-09 ref|XP_022851329.1| alanine--glyoxylate aminotransferase 2 homol... 61 3e-08 >ref|XP_011097618.1| alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial [Sesamum indicum] Length = 476 Score = 98.2 bits (243), Expect = 3e-21 Identities = 43/52 (82%), Positives = 48/52 (92%) Frame = +2 Query: 251 MRKLLSGSFVGSLIKDHSRRWLCSGNVGLQRGFSASAPPELPAFDYEPKPYK 406 MR L+SGS VG+LIK H+RRWLCSGNVGLQRGFS ++PPELPAFDYEPKPYK Sbjct: 1 MRNLVSGSLVGALIKSHTRRWLCSGNVGLQRGFSVTSPPELPAFDYEPKPYK 52 >ref|XP_012853518.1| PREDICTED: alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial [Erythranthe guttata] gb|EYU24029.1| hypothetical protein MIMGU_mgv1a005616mg [Erythranthe guttata] Length = 477 Score = 86.3 bits (212), Expect = 5e-17 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = +2 Query: 254 RKLLSGSFVGSLIKDHSRRWLCSGNVGLQRGFSASAPPELPAFDYEPKPY 403 RKLL GS VG+ +K+++RRWLC+ NVGLQRGFSA+APPELP FDY+PKPY Sbjct: 3 RKLLGGSVVGASVKNYTRRWLCTANVGLQRGFSAAAPPELPDFDYKPKPY 52 >gb|PIN03022.1| Alanine-glyoxylate aminotransferase AGT2 [Handroanthus impetiginosus] Length = 476 Score = 82.8 bits (203), Expect = 9e-16 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +2 Query: 254 RKLLSGSFVGSLIKDHSRRWLCSGNVGLQRGFSASAPPELPAFDYEPKPYK 406 RKLLSGSFV IK+H++RWLCSGNVGLQR SA+APP+LP FDY PKPYK Sbjct: 5 RKLLSGSFV---IKNHTKRWLCSGNVGLQRSCSAAAPPQLPPFDYVPKPYK 52 >gb|KZV35656.1| alanine--glyoxylate aminotransferase 21, mitochondrial [Dorcoceras hygrometricum] Length = 483 Score = 66.2 bits (160), Expect = 6e-10 Identities = 35/53 (66%), Positives = 38/53 (71%), Gaps = 2/53 (3%) Frame = +2 Query: 254 RKLLSGSFVGSLIKDHSRRWLCSGNVGLQRGFSASAP--PELPAFDYEPKPYK 406 RKL GS V +K+ R W CSGNVGL+RG SASAP P LP FDYEPKPYK Sbjct: 8 RKLSRGSLVRPFLKN-KRWWFCSGNVGLRRGVSASAPAKPVLPDFDYEPKPYK 59 >ref|XP_011090577.1| alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial [Sesamum indicum] Length = 478 Score = 63.9 bits (154), Expect = 4e-09 Identities = 33/52 (63%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = +2 Query: 254 RKLLSGSFVGSLIKDHSRRW-LCSGNVGLQRGFSASAPPELPAFDYEPKPYK 406 RKL + SF+ +LIK+ R W CS ++G +RGFSA A PELPAFDYEPKPYK Sbjct: 5 RKLTNRSFLRALIKN--RTWGYCSSSLGSERGFSALAAPELPAFDYEPKPYK 54 >ref|XP_022851329.1| alanine--glyoxylate aminotransferase 2 homolog 1, mitochondrial [Olea europaea var. sylvestris] Length = 476 Score = 61.2 bits (147), Expect = 3e-08 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = +2 Query: 254 RKLLSGSFVGSLIKDHSRRWLCSGNVGLQRGFSASAPPELPAFDYEPKPYK 406 R L G+F G+ K +WL S N GL RGFSA A PELP FDY+PKPYK Sbjct: 5 RNLSIGNFTGAFKKS---KWLLSDNAGLCRGFSAMAKPELPGFDYQPKPYK 52