BLASTX nr result
ID: Rehmannia29_contig00025245
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00025245 (952 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011085401.1| transcriptional adapter ADA2 isoform X2 [Ses... 70 1e-09 ref|XP_011085400.1| transcriptional adapter ADA2 isoform X1 [Ses... 70 1e-09 ref|XP_012830156.1| PREDICTED: transcriptional adapter ADA2 [Ery... 66 3e-08 ref|XP_018836316.1| PREDICTED: transcriptional adapter ADA2-like... 65 5e-08 ref|XP_018836315.1| PREDICTED: transcriptional adapter ADA2-like... 65 6e-08 ref|XP_018836314.1| PREDICTED: transcriptional adapter ADA2-like... 65 6e-08 emb|CDP17436.1| unnamed protein product [Coffea canephora] 64 1e-07 ref|XP_023873221.1| transcriptional adapter ADA2-like [Quercus s... 64 2e-07 gb|EOY01371.1| ADA2 2A isoform 5 [Theobroma cacao] 63 2e-07 ref|XP_021293198.1| transcriptional adapter ADA2a isoform X5 [He... 63 2e-07 ref|XP_021293200.1| transcriptional adapter ADA2a isoform X6 [He... 63 2e-07 ref|XP_022847781.1| transcriptional adapter ADA2-like [Olea euro... 62 2e-07 ref|XP_021293196.1| transcriptional adapter ADA2 isoform X4 [Her... 63 2e-07 gb|OMO72417.1| hypothetical protein COLO4_27626 [Corchorus olito... 63 2e-07 ref|XP_021293195.1| transcriptional adapter ADA2b isoform X3 [He... 63 2e-07 ref|XP_007045538.1| PREDICTED: transcriptional adapter ADA2a iso... 63 2e-07 gb|EOY01368.1| ADA2 2A isoform 2 [Theobroma cacao] 63 2e-07 ref|XP_017971760.1| PREDICTED: transcriptional adapter ADA2a iso... 63 2e-07 ref|XP_021293192.1| transcriptional adapter ADA2a isoform X2 [He... 63 2e-07 ref|XP_021293189.1| transcriptional adapter ADA2a isoform X1 [He... 63 2e-07 >ref|XP_011085401.1| transcriptional adapter ADA2 isoform X2 [Sesamum indicum] ref|XP_011085403.1| transcriptional adapter ADA2 isoform X2 [Sesamum indicum] ref|XP_020552165.1| transcriptional adapter ADA2 isoform X2 [Sesamum indicum] Length = 463 Score = 70.1 bits (170), Expect = 1e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 YRVFMRFHSKEEHDELLRS+VEEQRILKRIQDLQ Sbjct: 261 YRVFMRFHSKEEHDELLRSIVEEQRILKRIQDLQ 294 >ref|XP_011085400.1| transcriptional adapter ADA2 isoform X1 [Sesamum indicum] Length = 578 Score = 70.1 bits (170), Expect = 1e-09 Identities = 33/34 (97%), Positives = 34/34 (100%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 YRVFMRFHSKEEHDELLRS+VEEQRILKRIQDLQ Sbjct: 376 YRVFMRFHSKEEHDELLRSIVEEQRILKRIQDLQ 409 >ref|XP_012830156.1| PREDICTED: transcriptional adapter ADA2 [Erythranthe guttata] gb|EYU43182.1| hypothetical protein MIMGU_mgv1a003478mg [Erythranthe guttata] Length = 582 Score = 65.9 bits (159), Expect = 3e-08 Identities = 31/34 (91%), Positives = 34/34 (100%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 YRVFMRFHSK+EHDELL+SVVEEQRILKRIQ+LQ Sbjct: 376 YRVFMRFHSKKEHDELLKSVVEEQRILKRIQNLQ 409 >ref|XP_018836316.1| PREDICTED: transcriptional adapter ADA2-like isoform X3 [Juglans regia] Length = 507 Score = 65.1 bits (157), Expect = 5e-08 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 YRVFMRFHSKEEHDELL++++E+QRI+KRIQDLQ Sbjct: 308 YRVFMRFHSKEEHDELLKNIIEQQRIVKRIQDLQ 341 >ref|XP_018836315.1| PREDICTED: transcriptional adapter ADA2-like isoform X2 [Juglans regia] Length = 567 Score = 65.1 bits (157), Expect = 6e-08 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 YRVFMRFHSKEEHDELL++++E+QRI+KRIQDLQ Sbjct: 368 YRVFMRFHSKEEHDELLKNIIEQQRIVKRIQDLQ 401 >ref|XP_018836314.1| PREDICTED: transcriptional adapter ADA2-like isoform X1 [Juglans regia] Length = 569 Score = 65.1 bits (157), Expect = 6e-08 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 YRVFMRFHSKEEHDELL++++E+QRI+KRIQDLQ Sbjct: 370 YRVFMRFHSKEEHDELLKNIIEQQRIVKRIQDLQ 403 >emb|CDP17436.1| unnamed protein product [Coffea canephora] Length = 536 Score = 64.3 bits (155), Expect = 1e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 YRVFMRFHSKE+H+ELLRS+VEE R+LKRIQDLQ Sbjct: 335 YRVFMRFHSKEDHEELLRSLVEEHRVLKRIQDLQ 368 >ref|XP_023873221.1| transcriptional adapter ADA2-like [Quercus suber] ref|XP_023873222.1| transcriptional adapter ADA2-like [Quercus suber] Length = 581 Score = 63.5 bits (153), Expect = 2e-07 Identities = 27/34 (79%), Positives = 34/34 (100%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 Y+VFMRFHSKEEHDELL++++EEQ+I+KRIQDLQ Sbjct: 382 YKVFMRFHSKEEHDELLKNIIEEQQIVKRIQDLQ 415 >gb|EOY01371.1| ADA2 2A isoform 5 [Theobroma cacao] Length = 437 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 Y+VFMRFHSKEEH+ELL+SV+EE RI+KRIQDLQ Sbjct: 247 YKVFMRFHSKEEHEELLKSVIEEHRIVKRIQDLQ 280 >ref|XP_021293198.1| transcriptional adapter ADA2a isoform X5 [Herrania umbratica] ref|XP_021293199.1| transcriptional adapter ADA2a isoform X5 [Herrania umbratica] Length = 466 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 Y+VFMRFHSKEEH+ELL+SV+EE RI+KRIQDLQ Sbjct: 276 YKVFMRFHSKEEHEELLKSVIEEHRIVKRIQDLQ 309 >ref|XP_021293200.1| transcriptional adapter ADA2a isoform X6 [Herrania umbratica] Length = 466 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 Y+VFMRFHSKEEH+ELL+SV+EE RI+KRIQDLQ Sbjct: 276 YKVFMRFHSKEEHEELLKSVIEEHRIVKRIQDLQ 309 >ref|XP_022847781.1| transcriptional adapter ADA2-like [Olea europaea var. sylvestris] Length = 262 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/34 (79%), Positives = 32/34 (94%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 Y+VFMRFHS+EEH+ LLRS++EE RILKRIQDLQ Sbjct: 62 YKVFMRFHSREEHERLLRSIIEENRILKRIQDLQ 95 >ref|XP_021293196.1| transcriptional adapter ADA2 isoform X4 [Herrania umbratica] ref|XP_021293197.1| transcriptional adapter ADA2 isoform X4 [Herrania umbratica] Length = 532 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 Y+VFMRFHSKEEH+ELL+SV+EE RI+KRIQDLQ Sbjct: 342 YKVFMRFHSKEEHEELLKSVIEEHRIVKRIQDLQ 375 >gb|OMO72417.1| hypothetical protein COLO4_27626 [Corchorus olitorius] Length = 535 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 Y+VFMRFHSKEEH+ELL+SV+EE RI+KRIQDLQ Sbjct: 341 YKVFMRFHSKEEHEELLKSVIEEHRIVKRIQDLQ 374 >ref|XP_021293195.1| transcriptional adapter ADA2b isoform X3 [Herrania umbratica] Length = 541 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 Y+VFMRFHSKEEH+ELL+SV+EE RI+KRIQDLQ Sbjct: 351 YKVFMRFHSKEEHEELLKSVIEEHRIVKRIQDLQ 384 >ref|XP_007045538.1| PREDICTED: transcriptional adapter ADA2a isoform X2 [Theobroma cacao] ref|XP_017971762.1| PREDICTED: transcriptional adapter ADA2a isoform X2 [Theobroma cacao] gb|EOY01370.1| ADA2 2A isoform 4 [Theobroma cacao] Length = 562 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 Y+VFMRFHSKEEH+ELL+SV+EE RI+KRIQDLQ Sbjct: 372 YKVFMRFHSKEEHEELLKSVIEEHRIVKRIQDLQ 405 >gb|EOY01368.1| ADA2 2A isoform 2 [Theobroma cacao] Length = 562 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 Y+VFMRFHSKEEH+ELL+SV+EE RI+KRIQDLQ Sbjct: 373 YKVFMRFHSKEEHEELLKSVIEEHRIVKRIQDLQ 406 >ref|XP_017971760.1| PREDICTED: transcriptional adapter ADA2a isoform X1 [Theobroma cacao] ref|XP_017971761.1| PREDICTED: transcriptional adapter ADA2a isoform X1 [Theobroma cacao] gb|EOY01369.1| ADA2 2A isoform 3 [Theobroma cacao] Length = 563 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 Y+VFMRFHSKEEH+ELL+SV+EE RI+KRIQDLQ Sbjct: 373 YKVFMRFHSKEEHEELLKSVIEEHRIVKRIQDLQ 406 >ref|XP_021293192.1| transcriptional adapter ADA2a isoform X2 [Herrania umbratica] ref|XP_021293193.1| transcriptional adapter ADA2a isoform X2 [Herrania umbratica] ref|XP_021293194.1| transcriptional adapter ADA2a isoform X2 [Herrania umbratica] Length = 564 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 Y+VFMRFHSKEEH+ELL+SV+EE RI+KRIQDLQ Sbjct: 374 YKVFMRFHSKEEHEELLKSVIEEHRIVKRIQDLQ 407 >ref|XP_021293189.1| transcriptional adapter ADA2a isoform X1 [Herrania umbratica] ref|XP_021293190.1| transcriptional adapter ADA2a isoform X1 [Herrania umbratica] ref|XP_021293191.1| transcriptional adapter ADA2a isoform X1 [Herrania umbratica] Length = 565 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = -3 Query: 950 YRVFMRFHSKEEHDELLRSVVEEQRILKRIQDLQ 849 Y+VFMRFHSKEEH+ELL+SV+EE RI+KRIQDLQ Sbjct: 375 YKVFMRFHSKEEHEELLKSVIEEHRIVKRIQDLQ 408