BLASTX nr result
ID: Rehmannia29_contig00025001
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00025001 (424 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011076116.1| uncharacterized protein LOC105160444 [Sesamu... 65 2e-09 gb|PIN26450.1| hypothetical protein CDL12_00801 [Handroanthus im... 64 6e-09 >ref|XP_011076116.1| uncharacterized protein LOC105160444 [Sesamum indicum] Length = 455 Score = 64.7 bits (156), Expect = 2e-09 Identities = 31/55 (56%), Positives = 39/55 (70%) Frame = -3 Query: 188 VKLLFSQPTHSPPPPAKRTRVPSHQNASHIPNFQSPSFQDISLVTSSSNQHKPLN 24 +KLLFSQP + PPP +R+R SHQ S IP +SP QD SL+TSSSN+ + LN Sbjct: 3 LKLLFSQPINCHPPPLQRSRFASHQKPSQIPTARSPLIQDFSLLTSSSNKDRSLN 57 >gb|PIN26450.1| hypothetical protein CDL12_00801 [Handroanthus impetiginosus] Length = 454 Score = 63.5 bits (153), Expect = 6e-09 Identities = 32/62 (51%), Positives = 40/62 (64%) Frame = -3 Query: 188 VKLLFSQPTHSPPPPAKRTRVPSHQNASHIPNFQSPSFQDISLVTSSSNQHKPLNSPLKT 9 VKL F +PT+ PPPP +R+ P HQ + IP P FQD SL+ +SSN+ K LNS L Sbjct: 3 VKLPFCEPTYYPPPP-QRSCFPRHQRVTQIPTIHRPLFQDSSLIITSSNEEKSLNSALTP 61 Query: 8 TS 3 TS Sbjct: 62 TS 63