BLASTX nr result
ID: Rehmannia29_contig00024782
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00024782 (761 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU33187.1| hypothetical protein MIMGU_mgv1a000523mg [Erythra... 60 1e-06 >gb|EYU33187.1| hypothetical protein MIMGU_mgv1a000523mg [Erythranthe guttata] Length = 1097 Score = 60.5 bits (145), Expect = 1e-06 Identities = 26/33 (78%), Positives = 29/33 (87%) Frame = +3 Query: 3 RATTKSCWKIHTSRCVACFSCQTNDYLFRFQLS 101 +ATT+S WKIHT RCVACFSCQTN+YL FQLS Sbjct: 1057 QATTRSYWKIHTYRCVACFSCQTNNYLSHFQLS 1089