BLASTX nr result
ID: Rehmannia29_contig00024780
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00024780 (664 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080765.1| probable 2-oxoglutarate-dependent dioxygenas... 93 9e-19 ref|XP_012839928.1| PREDICTED: codeine O-demethylase-like [Eryth... 90 1e-17 gb|PIN09238.1| Iron/ascorbate family oxidoreductase [Handroanthu... 86 3e-16 ref|XP_016447568.1| PREDICTED: protein DMR6-LIKE OXYGENASE 2-lik... 83 7e-16 gb|EPS67689.1| hypothetical protein M569_07084, partial [Genlise... 85 9e-16 ref|XP_022858561.1| protein DMR6-LIKE OXYGENASE 2-like [Olea eur... 83 9e-16 gb|PHU10536.1| hypothetical protein BC332_22396 [Capsicum chinense] 85 1e-15 gb|PHT64405.1| hypothetical protein T459_31756 [Capsicum annuum] 85 1e-15 gb|PHT41966.1| hypothetical protein CQW23_20820 [Capsicum baccatum] 85 1e-15 ref|XP_016539669.1| PREDICTED: protein DMR6-LIKE OXYGENASE 2-lik... 85 1e-15 ref|XP_009616763.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-de... 85 1e-15 gb|POO03039.1| Isopenicillin N synthase [Trema orientalis] 84 1e-15 gb|PON49207.1| Oxoglutarate/iron-dependent dioxygenase [Paraspon... 81 6e-15 ref|XP_009771608.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-de... 83 6e-15 ref|XP_019224095.1| PREDICTED: protein DMR6-LIKE OXYGENASE 2-lik... 83 6e-15 ref|XP_019244644.1| PREDICTED: protein DMR6-LIKE OXYGENASE 2-lik... 83 6e-15 ref|XP_009616591.1| PREDICTED: 1-aminocyclopropane-1-carboxylate... 83 6e-15 gb|POO03042.1| Oxoglutarate/iron-dependent dioxygenase [Trema or... 81 8e-15 gb|PON57004.1| Isopenicillin N synthase [Parasponia andersonii] 82 1e-14 gb|KZV18777.1| 2-oxoglutarate and Fe(II)-dependent oxygenase sup... 82 1e-14 >ref|XP_011080765.1| probable 2-oxoglutarate-dependent dioxygenase At5g05600 [Sesamum indicum] Length = 348 Score = 93.2 bits (230), Expect = 9e-19 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSNDKYESVEHRVVVNS+KERFSIPYFLYPSHYTWVEPLEE Sbjct: 265 VWSNDKYESVEHRVVVNSDKERFSIPYFLYPSHYTWVEPLEE 306 >ref|XP_012839928.1| PREDICTED: codeine O-demethylase-like [Erythranthe guttata] gb|EYU45686.1| hypothetical protein MIMGU_mgv1a009289mg [Erythranthe guttata] Length = 347 Score = 90.1 bits (222), Expect = 1e-17 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSNDKYESVEHR VVNSEKER SIPYFLYPSHYTW+EPLEE Sbjct: 264 VWSNDKYESVEHRAVVNSEKERLSIPYFLYPSHYTWIEPLEE 305 >gb|PIN09238.1| Iron/ascorbate family oxidoreductase [Handroanthus impetiginosus] Length = 350 Score = 86.3 bits (212), Expect = 3e-16 Identities = 37/42 (88%), Positives = 40/42 (95%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSND+YESVEHRVVVNS+KER S PYFLYPSHYTWVEPL+E Sbjct: 267 VWSNDEYESVEHRVVVNSQKERLSFPYFLYPSHYTWVEPLKE 308 >ref|XP_016447568.1| PREDICTED: protein DMR6-LIKE OXYGENASE 2-like [Nicotiana tabacum] Length = 199 Score = 82.8 bits (203), Expect = 7e-16 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSN++YESVEHRV+VNSE+ERFSIP+FL P+HYTWVEPLEE Sbjct: 116 VWSNEEYESVEHRVMVNSERERFSIPFFLNPAHYTWVEPLEE 157 >gb|EPS67689.1| hypothetical protein M569_07084, partial [Genlisea aurea] Length = 353 Score = 85.1 bits (209), Expect = 9e-16 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSND+YESVEHRVVVNS ERFS+PYFLYP+HYTWVEPL E Sbjct: 271 VWSNDRYESVEHRVVVNSSAERFSVPYFLYPAHYTWVEPLPE 312 >ref|XP_022858561.1| protein DMR6-LIKE OXYGENASE 2-like [Olea europaea var. sylvestris] Length = 217 Score = 82.8 bits (203), Expect = 9e-16 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSNDKYESVEHRV+VNS+K+RFSIP+FL P+H+TWVEPLEE Sbjct: 135 VWSNDKYESVEHRVMVNSKKQRFSIPFFLNPAHFTWVEPLEE 176 >gb|PHU10536.1| hypothetical protein BC332_22396 [Capsicum chinense] Length = 353 Score = 84.7 bits (208), Expect = 1e-15 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSND+YESVEHRVVVNSE+ERFSIP+F PSHYTW+EPLEE Sbjct: 270 VWSNDEYESVEHRVVVNSERERFSIPFFFNPSHYTWIEPLEE 311 >gb|PHT64405.1| hypothetical protein T459_31756 [Capsicum annuum] Length = 353 Score = 84.7 bits (208), Expect = 1e-15 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSND+YESVEHRVVVNSE+ERFSIP+F PSHYTW+EPLEE Sbjct: 270 VWSNDEYESVEHRVVVNSERERFSIPFFFNPSHYTWIEPLEE 311 >gb|PHT41966.1| hypothetical protein CQW23_20820 [Capsicum baccatum] Length = 353 Score = 84.7 bits (208), Expect = 1e-15 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSND+YESVEHRVVVNSE+ERFSIP+F PSHYTW+EPLEE Sbjct: 270 VWSNDEYESVEHRVVVNSERERFSIPFFFNPSHYTWIEPLEE 311 >ref|XP_016539669.1| PREDICTED: protein DMR6-LIKE OXYGENASE 2-like [Capsicum annuum] Length = 353 Score = 84.7 bits (208), Expect = 1e-15 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSND+YESVEHRVVVNSE+ERFSIP+F PSHYTW+EPLEE Sbjct: 270 VWSNDEYESVEHRVVVNSERERFSIPFFFNPSHYTWIEPLEE 311 >ref|XP_009616763.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase [Nicotiana tomentosiformis] ref|XP_016475036.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase [Nicotiana tabacum] Length = 353 Score = 84.7 bits (208), Expect = 1e-15 Identities = 36/42 (85%), Positives = 41/42 (97%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSND+YESVEHRVVVNSE+ERFSIP+FL PSHYTW+EPLE+ Sbjct: 270 VWSNDEYESVEHRVVVNSERERFSIPFFLNPSHYTWIEPLEK 311 >gb|POO03039.1| Isopenicillin N synthase [Trema orientalis] Length = 343 Score = 84.3 bits (207), Expect = 1e-15 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSNDKYESVEHRV+VNSEKERFSIP+FLYP+HYT V+PLEE Sbjct: 258 VWSNDKYESVEHRVMVNSEKERFSIPFFLYPAHYTMVKPLEE 299 >gb|PON49207.1| Oxoglutarate/iron-dependent dioxygenase [Parasponia andersonii] Length = 223 Score = 80.9 bits (198), Expect = 6e-15 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSNDKYESVEHRV+VNSEKERFSIP+FL P+HYT V+PLEE Sbjct: 116 VWSNDKYESVEHRVMVNSEKERFSIPFFLTPAHYTMVKPLEE 157 >ref|XP_009771608.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase [Nicotiana sylvestris] ref|XP_016467431.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase [Nicotiana tabacum] Length = 352 Score = 82.8 bits (203), Expect = 6e-15 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSN++YESVEHRVVVNSEKERFSIP+FL PSHYTW+ PLEE Sbjct: 269 VWSNNEYESVEHRVVVNSEKERFSIPFFLNPSHYTWIGPLEE 310 >ref|XP_019224095.1| PREDICTED: protein DMR6-LIKE OXYGENASE 2-like [Nicotiana attenuata] gb|OIT33605.1| feruloyl coa ortho-hydroxylase 2 [Nicotiana attenuata] Length = 353 Score = 82.8 bits (203), Expect = 6e-15 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSN++YESVEHRVVVNSEKERFSIP+FL PSHYTW+ PLEE Sbjct: 270 VWSNNEYESVEHRVVVNSEKERFSIPFFLNPSHYTWIGPLEE 311 >ref|XP_019244644.1| PREDICTED: protein DMR6-LIKE OXYGENASE 2-like [Nicotiana attenuata] gb|OIT04458.1| feruloyl coa ortho-hydroxylase 2 [Nicotiana attenuata] Length = 354 Score = 82.8 bits (203), Expect = 6e-15 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSN++YESVEHRV+VNSE+ERFSIP+FL P+HYTWVEPLEE Sbjct: 271 VWSNEEYESVEHRVMVNSERERFSIPFFLNPAHYTWVEPLEE 312 >ref|XP_009616591.1| PREDICTED: 1-aminocyclopropane-1-carboxylate oxidase 5-like [Nicotiana tomentosiformis] Length = 354 Score = 82.8 bits (203), Expect = 6e-15 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSN++YESVEHRV+VNSE+ERFSIP+FL P+HYTWVEPLEE Sbjct: 271 VWSNEEYESVEHRVMVNSERERFSIPFFLNPAHYTWVEPLEE 312 >gb|POO03042.1| Oxoglutarate/iron-dependent dioxygenase [Trema orientalis] Length = 243 Score = 80.9 bits (198), Expect = 8e-15 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSNDKYESVEHRV+VNSEKERFSIP+FL P+HYT V+PLEE Sbjct: 116 VWSNDKYESVEHRVMVNSEKERFSIPFFLTPAHYTMVKPLEE 157 >gb|PON57004.1| Isopenicillin N synthase [Parasponia andersonii] Length = 343 Score = 82.0 bits (201), Expect = 1e-14 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSNDKYESVEHRV+VNSEKER SIP+FLYP+HYT V+PLEE Sbjct: 258 VWSNDKYESVEHRVMVNSEKERLSIPFFLYPAHYTMVKPLEE 299 >gb|KZV18777.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein [Dorcoceras hygrometricum] Length = 349 Score = 81.6 bits (200), Expect = 1e-14 Identities = 35/42 (83%), Positives = 38/42 (90%) Frame = +3 Query: 537 VWSNDKYESVEHRVVVNSEKERFSIPYFLYPSHYTWVEPLEE 662 VWSNDKYESVEHR +VNSEK RFSIP+F P+HYTWVEPLEE Sbjct: 266 VWSNDKYESVEHRAMVNSEKARFSIPFFFNPAHYTWVEPLEE 307