BLASTX nr result
ID: Rehmannia29_contig00024513
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00024513 (789 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ONK70689.1| uncharacterized protein A4U43_C04F500 [Asparagus ... 55 3e-06 ref|XP_010249925.1| PREDICTED: probable inactive receptor kinase... 58 8e-06 ref|XP_021646247.1| probable inactive receptor kinase At2g26730 ... 58 8e-06 ref|XP_021644516.1| probable inactive receptor kinase At2g26730 ... 58 8e-06 ref|XP_006475765.1| PREDICTED: probable inactive receptor kinase... 58 8e-06 ref|XP_006451035.1| probable inactive receptor kinase At2g26730 ... 58 8e-06 >gb|ONK70689.1| uncharacterized protein A4U43_C04F500 [Asparagus officinalis] Length = 87 Score = 54.7 bits (130), Expect = 3e-06 Identities = 25/32 (78%), Positives = 28/32 (87%) Frame = +1 Query: 1 FYYSKDEKLLVYDYMPAGSLSALLHGNSCLLR 96 +Y+SKDEKLLVYD+MP GSLSALLHGN LR Sbjct: 39 YYFSKDEKLLVYDFMPLGSLSALLHGNITPLR 70 >ref|XP_010249925.1| PREDICTED: probable inactive receptor kinase At2g26730 [Nelumbo nucifera] Length = 649 Score = 57.8 bits (138), Expect = 8e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 FYYSKDEKLLVYDYMPAGSLSALLHGN 81 FYYSKDEKLLVYDYMPAGSLSALLHG+ Sbjct: 404 FYYSKDEKLLVYDYMPAGSLSALLHGS 430 >ref|XP_021646247.1| probable inactive receptor kinase At2g26730 [Hevea brasiliensis] Length = 653 Score = 57.8 bits (138), Expect = 8e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 FYYSKDEKLLVYDYMPAGSLSALLHGN 81 FYYSKDEKLLVYDYMPAGSLSALLHG+ Sbjct: 408 FYYSKDEKLLVYDYMPAGSLSALLHGS 434 >ref|XP_021644516.1| probable inactive receptor kinase At2g26730 [Hevea brasiliensis] Length = 653 Score = 57.8 bits (138), Expect = 8e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 FYYSKDEKLLVYDYMPAGSLSALLHGN 81 FYYSKDEKLLVYDYMPAGSLSALLHG+ Sbjct: 408 FYYSKDEKLLVYDYMPAGSLSALLHGS 434 >ref|XP_006475765.1| PREDICTED: probable inactive receptor kinase At2g26730 [Citrus sinensis] gb|KDO80389.1| hypothetical protein CISIN_1g036334mg [Citrus sinensis] dbj|GAY50517.1| hypothetical protein CUMW_127290 [Citrus unshiu] dbj|GAY50518.1| hypothetical protein CUMW_127290 [Citrus unshiu] Length = 654 Score = 57.8 bits (138), Expect = 8e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 FYYSKDEKLLVYDYMPAGSLSALLHGN 81 FYYSKDEKLLVYDYMPAGSLSALLHG+ Sbjct: 409 FYYSKDEKLLVYDYMPAGSLSALLHGS 435 >ref|XP_006451035.1| probable inactive receptor kinase At2g26730 [Citrus clementina] gb|ESR64274.1| hypothetical protein CICLE_v10007694mg [Citrus clementina] gb|ESR64275.1| hypothetical protein CICLE_v10007694mg [Citrus clementina] Length = 654 Score = 57.8 bits (138), Expect = 8e-06 Identities = 26/27 (96%), Positives = 27/27 (100%) Frame = +1 Query: 1 FYYSKDEKLLVYDYMPAGSLSALLHGN 81 FYYSKDEKLLVYDYMPAGSLSALLHG+ Sbjct: 409 FYYSKDEKLLVYDYMPAGSLSALLHGS 435