BLASTX nr result
ID: Rehmannia29_contig00024350
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00024350 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012833635.1| PREDICTED: protein cornichon homolog 4-like ... 86 1e-18 gb|PIN27087.1| ER vesicle integral membrane protein [Handroanthu... 85 5e-18 ref|XP_022866798.1| protein cornichon homolog 4-like [Olea europ... 84 1e-17 gb|KZV19435.1| protein cornichon4 [Dorcoceras hygrometricum] 84 1e-17 ref|XP_011081105.1| protein cornichon homolog 4 [Sesamum indicum] 83 3e-17 ref|XP_022881165.1| protein cornichon homolog 4-like [Olea europ... 82 4e-17 ref|XP_012845697.1| PREDICTED: protein cornichon homolog 4-like ... 79 6e-16 gb|PHU14641.1| Protein cornichon -like protein 4 [Capsicum chine... 78 2e-15 gb|PHT29909.1| Protein cornichon -like protein 4 [Capsicum bacca... 77 3e-15 ref|XP_016575131.1| PREDICTED: protein cornichon homolog 4 [Caps... 77 3e-15 ref|XP_006363909.1| PREDICTED: protein cornichon homolog 4 [Sola... 77 3e-15 ref|XP_004242012.1| PREDICTED: protein cornichon homolog 4 [Sola... 77 5e-15 ref|XP_021972499.1| protein cornichon homolog 4-like [Helianthus... 76 1e-14 gb|EPS74239.1| hypothetical protein M569_00515, partial [Genlise... 76 1e-14 gb|PIN02844.1| ER vesicle integral membrane protein [Handroanthu... 74 3e-14 gb|KVH90036.1| Cornichon [Cynara cardunculus var. scolymus] 75 4e-14 ref|XP_022873865.1| protein cornichon homolog 4-like [Olea europ... 74 7e-14 ref|XP_023770142.1| protein cornichon homolog 4-like [Lactuca sa... 74 1e-13 dbj|GAV70359.1| Cornichon domain-containing protein [Cephalotus ... 74 1e-13 ref|XP_016900572.1| PREDICTED: probable protein cornichon homolo... 73 1e-13 >ref|XP_012833635.1| PREDICTED: protein cornichon homolog 4-like [Erythranthe guttata] gb|EYU40573.1| hypothetical protein MIMGU_mgv1a016042mg [Erythranthe guttata] Length = 136 Score = 86.3 bits (212), Expect = 1e-18 Identities = 39/40 (97%), Positives = 40/40 (100%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFNLLNWEKKQRLFKLGYVIL+LFMCLFWMIYNALED Sbjct: 95 VTEIFNLLNWEKKQRLFKLGYVILLLFMCLFWMIYNALED 134 >gb|PIN27087.1| ER vesicle integral membrane protein [Handroanthus impetiginosus] Length = 136 Score = 84.7 bits (208), Expect = 5e-18 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFNLLNWEKKQRLFKLGY+IL+LFMCLFW+IYNALED Sbjct: 95 VTEIFNLLNWEKKQRLFKLGYIILLLFMCLFWLIYNALED 134 >ref|XP_022866798.1| protein cornichon homolog 4-like [Olea europaea var. sylvestris] Length = 139 Score = 84.0 bits (206), Expect = 1e-17 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFNLLNWEKKQRLFKLGYVIL LFMCLFWMIYNALE+ Sbjct: 95 VTEIFNLLNWEKKQRLFKLGYVILFLFMCLFWMIYNALEE 134 >gb|KZV19435.1| protein cornichon4 [Dorcoceras hygrometricum] Length = 139 Score = 84.0 bits (206), Expect = 1e-17 Identities = 37/40 (92%), Positives = 40/40 (100%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFNLL+WEKKQRLFKLGY+IL+LFMCLFWMIYNALED Sbjct: 95 VTEIFNLLSWEKKQRLFKLGYIILLLFMCLFWMIYNALED 134 >ref|XP_011081105.1| protein cornichon homolog 4 [Sesamum indicum] Length = 139 Score = 82.8 bits (203), Expect = 3e-17 Identities = 36/40 (90%), Positives = 40/40 (100%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFNLLNWEKKQRLFKLGY+IL+LFMCLFWMI+NALE+ Sbjct: 95 VTEIFNLLNWEKKQRLFKLGYIILLLFMCLFWMIFNALEE 134 >ref|XP_022881165.1| protein cornichon homolog 4-like [Olea europaea var. sylvestris] Length = 139 Score = 82.4 bits (202), Expect = 4e-17 Identities = 38/40 (95%), Positives = 39/40 (97%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFNLLNWEKKQRLFKLGYVIL+LFM LFWMIYNALED Sbjct: 95 VTEIFNLLNWEKKQRLFKLGYVILLLFMSLFWMIYNALED 134 >ref|XP_012845697.1| PREDICTED: protein cornichon homolog 4-like [Erythranthe guttata] gb|EYU30463.1| hypothetical protein MIMGU_mgv1a015975mg [Erythranthe guttata] Length = 139 Score = 79.3 bits (194), Expect = 6e-16 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFN+LNWEKKQRLFKLGY IL++FMCLFWMIY ALE+ Sbjct: 95 VTEIFNMLNWEKKQRLFKLGYTILLIFMCLFWMIYKALEE 134 >gb|PHU14641.1| Protein cornichon -like protein 4 [Capsicum chinense] Length = 139 Score = 77.8 bits (190), Expect = 2e-15 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFNLLNWEKKQRLFKLGY+IL+LF+ LFW+IY+ALED Sbjct: 95 VTEIFNLLNWEKKQRLFKLGYIILLLFLSLFWLIYSALED 134 >gb|PHT29909.1| Protein cornichon -like protein 4 [Capsicum baccatum] Length = 139 Score = 77.4 bits (189), Expect = 3e-15 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFNLLNWEKKQRLFKLGY+IL+LF+ LFW+IY+ALED Sbjct: 95 VTEIFNLLNWEKKQRLFKLGYIILLLFVSLFWLIYSALED 134 >ref|XP_016575131.1| PREDICTED: protein cornichon homolog 4 [Capsicum annuum] gb|PHT78863.1| Protein cornichon -like protein 4 [Capsicum annuum] Length = 139 Score = 77.4 bits (189), Expect = 3e-15 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFNLLNWEKKQRLFKLGY+IL+LF+ LFW+IY+ALED Sbjct: 95 VTEIFNLLNWEKKQRLFKLGYIILLLFVSLFWLIYSALED 134 >ref|XP_006363909.1| PREDICTED: protein cornichon homolog 4 [Solanum tuberosum] Length = 139 Score = 77.4 bits (189), Expect = 3e-15 Identities = 34/40 (85%), Positives = 39/40 (97%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFNLLNWEKKQRLFKLGY+IL+LF+ LFW+IY+ALED Sbjct: 95 VTEIFNLLNWEKKQRLFKLGYIILLLFISLFWLIYSALED 134 >ref|XP_004242012.1| PREDICTED: protein cornichon homolog 4 [Solanum lycopersicum] ref|XP_015077568.1| PREDICTED: protein cornichon homolog 4 [Solanum pennellii] Length = 139 Score = 77.0 bits (188), Expect = 5e-15 Identities = 33/40 (82%), Positives = 39/40 (97%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFNLLNWEKKQRLFKLGY++L+LF+ LFW+IY+ALED Sbjct: 95 VTEIFNLLNWEKKQRLFKLGYIVLLLFISLFWLIYSALED 134 >ref|XP_021972499.1| protein cornichon homolog 4-like [Helianthus annuus] gb|OTG20042.1| putative cornichon family protein [Helianthus annuus] Length = 137 Score = 75.9 bits (185), Expect = 1e-14 Identities = 34/40 (85%), Positives = 37/40 (92%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFN LNWEKKQRLFKLGY+I +LF+ LFWMIYNALED Sbjct: 95 VTEIFNQLNWEKKQRLFKLGYLIFLLFITLFWMIYNALED 134 >gb|EPS74239.1| hypothetical protein M569_00515, partial [Genlisea aurea] Length = 138 Score = 75.9 bits (185), Expect = 1e-14 Identities = 33/40 (82%), Positives = 38/40 (95%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFN LNWEKKQRL KLGY++L+LFMCLFWMIY+ALE+ Sbjct: 95 VTEIFNELNWEKKQRLVKLGYLVLLLFMCLFWMIYSALEE 134 >gb|PIN02844.1| ER vesicle integral membrane protein [Handroanthus impetiginosus] Length = 114 Score = 74.3 bits (181), Expect = 3e-14 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFN LNWEKKQRLFKLGY++L+LFM LFWMIY AL++ Sbjct: 70 VTEIFNQLNWEKKQRLFKLGYIVLLLFMSLFWMIYTALDE 109 >gb|KVH90036.1| Cornichon [Cynara cardunculus var. scolymus] Length = 137 Score = 74.7 bits (182), Expect = 4e-14 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFN LNWEKKQRLFKLGY+I +LF+ LFWMIYNAL+D Sbjct: 95 VTEIFNQLNWEKKQRLFKLGYLIFLLFITLFWMIYNALDD 134 >ref|XP_022873865.1| protein cornichon homolog 4-like [Olea europaea var. sylvestris] Length = 136 Score = 73.9 bits (180), Expect = 7e-14 Identities = 31/40 (77%), Positives = 38/40 (95%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFNLL+WEKKQR+ KLGY++++LF+ LFWMIYNALED Sbjct: 95 VTEIFNLLSWEKKQRIIKLGYIVVLLFISLFWMIYNALED 134 >ref|XP_023770142.1| protein cornichon homolog 4-like [Lactuca sativa] gb|PLY80549.1| hypothetical protein LSAT_6X9661 [Lactuca sativa] Length = 137 Score = 73.6 bits (179), Expect = 1e-13 Identities = 33/40 (82%), Positives = 37/40 (92%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFN L+WEKKQRLFKLGY+I +LF+ LFWMIYNALED Sbjct: 95 VTEIFNHLSWEKKQRLFKLGYLIFLLFITLFWMIYNALED 134 >dbj|GAV70359.1| Cornichon domain-containing protein [Cephalotus follicularis] Length = 137 Score = 73.6 bits (179), Expect = 1e-13 Identities = 32/40 (80%), Positives = 37/40 (92%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFNLL+WEKKQRL KLGY+I +LF+ +FWMIYNALED Sbjct: 95 VTEIFNLLHWEKKQRLIKLGYLIFLLFLTIFWMIYNALED 134 >ref|XP_016900572.1| PREDICTED: probable protein cornichon homolog 2 isoform X2 [Cucumis melo] Length = 112 Score = 72.8 bits (177), Expect = 1e-13 Identities = 30/40 (75%), Positives = 38/40 (95%) Frame = -1 Query: 463 VTEIFNLLNWEKKQRLFKLGYVILILFMCLFWMIYNALED 344 VTEIFN+LNWEKKQRLFKL Y++++LF+ +FWMIY+ALED Sbjct: 71 VTEIFNMLNWEKKQRLFKLAYLVVLLFLSIFWMIYHALED 110