BLASTX nr result
ID: Rehmannia29_contig00024243
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00024243 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM98702.1| hypothetical protein CDL12_28816 [Handroanthus im... 74 2e-13 >gb|PIM98702.1| hypothetical protein CDL12_28816 [Handroanthus impetiginosus] Length = 188 Score = 73.9 bits (180), Expect = 2e-13 Identities = 34/50 (68%), Positives = 41/50 (82%) Frame = -3 Query: 196 MNQSQRNINSDEQIQREIDKLDSTNKKQEQNIRNLESKAIQNVNLYFIFQ 47 M+Q+ RN S+E IQ+EIDKLD NKKQE+ +RNLE K +QNVNLYFIFQ Sbjct: 1 MDQTHRNTTSEEPIQKEIDKLDRKNKKQEKTVRNLEIKVVQNVNLYFIFQ 50