BLASTX nr result
ID: Rehmannia29_contig00023979
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00023979 (887 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN08926.1| TPR-containing nuclear phosphoprotein that regula... 67 1e-08 ref|XP_011078071.1| protein CTR9 homolog [Sesamum indicum] 67 1e-08 gb|EYU28341.1| hypothetical protein MIMGU_mgv1a000572mg [Erythra... 66 2e-08 ref|XP_012848050.1| PREDICTED: protein CTR9 homolog [Erythranthe... 66 2e-08 gb|EPS64759.1| hypothetical protein M569_10012, partial [Genlise... 65 7e-08 ref|XP_022880527.1| protein CTR9 homolog [Olea europaea var. syl... 63 2e-07 gb|KZV31994.1| hypothetical protein F511_05104 [Dorcoceras hygro... 62 4e-07 gb|ONK66574.1| uncharacterized protein A4U43_C06F9750 [Asparagus... 55 6e-06 >gb|PIN08926.1| TPR-containing nuclear phosphoprotein that regulates K(+) uptake [Handroanthus impetiginosus] Length = 1098 Score = 67.4 bits (163), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 3 LKAIGHIYIQLEQNEKAQELFRKATKIDPRDPQ 101 LKA+GHIY+QLEQN+KAQELFRKATKIDPRDPQ Sbjct: 378 LKALGHIYVQLEQNDKAQELFRKATKIDPRDPQ 410 >ref|XP_011078071.1| protein CTR9 homolog [Sesamum indicum] Length = 1115 Score = 67.4 bits (163), Expect = 1e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 3 LKAIGHIYIQLEQNEKAQELFRKATKIDPRDPQ 101 LKA+GHIY+QLEQNEKAQELF+KATKIDPRDPQ Sbjct: 378 LKALGHIYVQLEQNEKAQELFKKATKIDPRDPQ 410 >gb|EYU28341.1| hypothetical protein MIMGU_mgv1a000572mg [Erythranthe guttata] Length = 1064 Score = 66.2 bits (160), Expect = 2e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 3 LKAIGHIYIQLEQNEKAQELFRKATKIDPRDPQ 101 LKA+GHIYIQL+QNEKAQELFRKA+KIDPRDPQ Sbjct: 340 LKALGHIYIQLDQNEKAQELFRKASKIDPRDPQ 372 >ref|XP_012848050.1| PREDICTED: protein CTR9 homolog [Erythranthe guttata] Length = 1102 Score = 66.2 bits (160), Expect = 2e-08 Identities = 30/33 (90%), Positives = 33/33 (100%) Frame = +3 Query: 3 LKAIGHIYIQLEQNEKAQELFRKATKIDPRDPQ 101 LKA+GHIYIQL+QNEKAQELFRKA+KIDPRDPQ Sbjct: 378 LKALGHIYIQLDQNEKAQELFRKASKIDPRDPQ 410 >gb|EPS64759.1| hypothetical protein M569_10012, partial [Genlisea aurea] Length = 919 Score = 64.7 bits (156), Expect = 7e-08 Identities = 28/33 (84%), Positives = 33/33 (100%) Frame = +3 Query: 3 LKAIGHIYIQLEQNEKAQELFRKATKIDPRDPQ 101 LKA+G++Y+QLEQNEKAQEL+RKATKIDPRDPQ Sbjct: 340 LKALGYVYVQLEQNEKAQELYRKATKIDPRDPQ 372 >ref|XP_022880527.1| protein CTR9 homolog [Olea europaea var. sylvestris] Length = 1204 Score = 63.2 bits (152), Expect = 2e-07 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +3 Query: 3 LKAIGHIYIQLEQNEKAQELFRKATKIDPRDPQ 101 LKA+GHIY QL QNEKAQELF+KATK+DPRDPQ Sbjct: 379 LKALGHIYFQLGQNEKAQELFKKATKVDPRDPQ 411 >gb|KZV31994.1| hypothetical protein F511_05104 [Dorcoceras hygrometricum] Length = 1118 Score = 62.4 bits (150), Expect = 4e-07 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = +3 Query: 3 LKAIGHIYIQLEQNEKAQELFRKATKIDPRDPQ 101 LKA+GHIY QL+Q EKAQELFRKATKIDPRDPQ Sbjct: 378 LKALGHIYAQLDQIEKAQELFRKATKIDPRDPQ 410 >gb|ONK66574.1| uncharacterized protein A4U43_C06F9750 [Asparagus officinalis] Length = 105 Score = 54.7 bits (130), Expect = 6e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +3 Query: 3 LKAIGHIYIQLEQNEKAQELFRKATKIDPRDPQVTM 110 +KA+GHIY+QL QNEKA E+F KA +IDPRD Q M Sbjct: 1 MKAVGHIYVQLGQNEKALEIFSKAARIDPRDAQAFM 36