BLASTX nr result
ID: Rehmannia29_contig00023867
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00023867 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN02486.1| hypothetical protein CDL12_25000 [Handroanthus im... 59 2e-07 ref|XP_011084072.1| uncharacterized protein LOC105166426 isoform... 59 2e-07 ref|XP_020550869.1| uncharacterized protein LOC105166426 isoform... 59 2e-07 ref|XP_012833625.1| PREDICTED: uncharacterized protein LOC105954... 59 2e-07 >gb|PIN02486.1| hypothetical protein CDL12_25000 [Handroanthus impetiginosus] Length = 227 Score = 58.5 bits (140), Expect = 2e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 431 TWLVEVNIDRCRMDEIFASVGGEMHIDFLETFG 333 TWLVEVNIDR R+D+IFA+VGGEMH +FLET G Sbjct: 195 TWLVEVNIDRYRVDDIFATVGGEMHFNFLETSG 227 >ref|XP_011084072.1| uncharacterized protein LOC105166426 isoform X2 [Sesamum indicum] Length = 297 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 431 TWLVEVNIDRCRMDEIFASVGGEMHIDF 348 TWLVEVNIDRCR+DEIFA VGGEMH+DF Sbjct: 269 TWLVEVNIDRCRVDEIFAIVGGEMHVDF 296 >ref|XP_020550869.1| uncharacterized protein LOC105166426 isoform X1 [Sesamum indicum] Length = 316 Score = 58.9 bits (141), Expect = 2e-07 Identities = 25/28 (89%), Positives = 27/28 (96%) Frame = -1 Query: 431 TWLVEVNIDRCRMDEIFASVGGEMHIDF 348 TWLVEVNIDRCR+DEIFA VGGEMH+DF Sbjct: 288 TWLVEVNIDRCRVDEIFAIVGGEMHVDF 315 >ref|XP_012833625.1| PREDICTED: uncharacterized protein LOC105954501 [Erythranthe guttata] Length = 331 Score = 58.9 bits (141), Expect = 2e-07 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = -1 Query: 431 TWLVEVNIDRCRMDEIFASVGGEMHIDFLETFG 333 TWLVEVNIDRCR+DEIF VGGEM +DF ET G Sbjct: 299 TWLVEVNIDRCRVDEIFDIVGGEMRVDFSETLG 331