BLASTX nr result
ID: Rehmannia29_contig00023851
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00023851 (1114 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094283.1| conserved oligomeric Golgi complex subunit 1... 71 1e-09 gb|PIN16662.1| Low density lipoprotein B-like protein [Handroant... 62 2e-06 ref|XP_012828743.1| PREDICTED: conserved oligomeric Golgi comple... 60 5e-06 >ref|XP_011094283.1| conserved oligomeric Golgi complex subunit 1 [Sesamum indicum] ref|XP_020553509.1| conserved oligomeric Golgi complex subunit 1 [Sesamum indicum] Length = 1061 Score = 71.2 bits (173), Expect = 1e-09 Identities = 34/48 (70%), Positives = 41/48 (85%) Frame = -2 Query: 1113 EKVSETSTVKAPLRRKQKVQQPKSFEGQRPTELVNRLSQRLDPIDWLT 970 +++SE S +KAPLRRKQK QQP+S G+R +LVNRLSQRLDPIDWLT Sbjct: 849 DELSEISKLKAPLRRKQKPQQPQSVMGERIKQLVNRLSQRLDPIDWLT 896 >gb|PIN16662.1| Low density lipoprotein B-like protein [Handroanthus impetiginosus] Length = 1062 Score = 61.6 bits (148), Expect = 2e-06 Identities = 30/48 (62%), Positives = 35/48 (72%) Frame = -2 Query: 1113 EKVSETSTVKAPLRRKQKVQQPKSFEGQRPTELVNRLSQRLDPIDWLT 970 E+ S +K+P RRKQ QQPKS G R EL+N+LSQRLDPIDWLT Sbjct: 850 EESPAISNLKSPFRRKQIAQQPKSIIGGRTKELLNQLSQRLDPIDWLT 897 >ref|XP_012828743.1| PREDICTED: conserved oligomeric Golgi complex subunit 1 [Erythranthe guttata] gb|EYU18079.1| hypothetical protein MIMGU_mgv1a000581mg [Erythranthe guttata] Length = 1060 Score = 60.1 bits (144), Expect = 5e-06 Identities = 29/48 (60%), Positives = 35/48 (72%) Frame = -2 Query: 1113 EKVSETSTVKAPLRRKQKVQQPKSFEGQRPTELVNRLSQRLDPIDWLT 970 E +SE T ++P RRKQK QQ + G+R LVN+LSQRLDPIDWLT Sbjct: 848 EDLSEIFTGRSPFRRKQKAQQSNTVIGERTKPLVNQLSQRLDPIDWLT 895