BLASTX nr result
ID: Rehmannia29_contig00023562
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00023562 (672 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_398843.1| hypothetical protein NitoCp007 [Nicotiana tomen... 73 3e-13 emb|CAJ32479.1| hypothetical protein (chloroplast) [Nicotiana ta... 73 3e-13 ref|YP_004891584.1| unnamed protein product (chloroplast) [Nicot... 73 3e-13 >ref|YP_398843.1| hypothetical protein NitoCp007 [Nicotiana tomentosiformis] dbj|BAE47981.1| hypothetical protein (chloroplast) [Nicotiana tomentosiformis] Length = 90 Score = 72.8 bits (177), Expect = 3e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +3 Query: 3 GKRGIRTLGTNNSYNGLAIRRFSPLSHLSQLKKIITT 113 GKRGIRTLGT NSYNGLAIRRFSPLSHLSQLKKIITT Sbjct: 54 GKRGIRTLGTINSYNGLAIRRFSPLSHLSQLKKIITT 90 >emb|CAJ32479.1| hypothetical protein (chloroplast) [Nicotiana tabacum] Length = 90 Score = 72.8 bits (177), Expect = 3e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +3 Query: 3 GKRGIRTLGTNNSYNGLAIRRFSPLSHLSQLKKIITT 113 GKRGIRTLGT NSYNGLAIRRFSPLSHLSQLKKIITT Sbjct: 54 GKRGIRTLGTINSYNGLAIRRFSPLSHLSQLKKIITT 90 >ref|YP_004891584.1| unnamed protein product (chloroplast) [Nicotiana undulata] gb|AEO95543.1| hypothetical protein (chloroplast) [Nicotiana undulata] gb|AEO95653.1| hypothetical protein [synthetic construct] Length = 90 Score = 72.8 bits (177), Expect = 3e-13 Identities = 36/37 (97%), Positives = 36/37 (97%) Frame = +3 Query: 3 GKRGIRTLGTNNSYNGLAIRRFSPLSHLSQLKKIITT 113 GKRGIRTLGT NSYNGLAIRRFSPLSHLSQLKKIITT Sbjct: 54 GKRGIRTLGTINSYNGLAIRRFSPLSHLSQLKKIITT 90