BLASTX nr result
ID: Rehmannia29_contig00023522
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00023522 (441 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022871415.1| oxidation resistance protein 1 isoform X2 [O... 144 8e-40 ref|XP_022871413.1| oxidation resistance protein 1 isoform X1 [O... 144 2e-39 ref|XP_012837029.1| PREDICTED: TLD domain-containing protein 2 i... 142 4e-39 gb|PIN09271.1| Oxidation resistance protein [Handroanthus impeti... 142 1e-38 ref|XP_012837028.1| PREDICTED: TLD domain-containing protein 2 i... 142 3e-38 ref|XP_011088361.1| TLD domain-containing protein 2 [Sesamum ind... 141 5e-38 ref|XP_002285459.2| PREDICTED: oxidation resistance protein 1 is... 139 1e-37 gb|ONI26816.1| hypothetical protein PRUPE_1G047600 [Prunus persica] 134 5e-36 ref|XP_021828989.1| TLD domain-containing protein 2 isoform X2 [... 134 7e-36 ref|XP_020411452.1| TLD domain-containing protein 2 isoform X2 [... 134 7e-36 gb|PHT33026.1| hypothetical protein CQW23_29363 [Capsicum baccatum] 130 1e-35 ref|XP_009334196.1| PREDICTED: TLD domain-containing protein 2-l... 134 1e-35 ref|XP_021828988.1| TLD domain-containing protein 2 isoform X1 [... 134 1e-35 ref|XP_020411451.1| TLD domain-containing protein 2 isoform X1 [... 134 1e-35 ref|XP_008245267.1| PREDICTED: TLD domain-containing protein 2 [... 134 1e-35 ref|XP_010262444.1| PREDICTED: oxidation resistance protein 1-li... 133 2e-35 ref|XP_024193479.1| oxidation resistance protein 1 isoform X3 [R... 132 3e-35 ref|XP_015162036.1| PREDICTED: oxidation resistance protein 1-li... 132 4e-35 ref|XP_007035247.1| PREDICTED: oxidation resistance protein 1 is... 133 4e-35 ref|XP_021290889.1| oxidation resistance protein 1 isoform X2 [H... 133 5e-35 >ref|XP_022871415.1| oxidation resistance protein 1 isoform X2 [Olea europaea var. sylvestris] Length = 292 Score = 144 bits (364), Expect = 8e-40 Identities = 67/71 (94%), Positives = 67/71 (94%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRYFYLCLND IALGGG NFAL LNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL Sbjct: 222 TGANRYFYLCLNDLIALGGGANFALRLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 281 Query: 181 WGFTHASQYLN 213 WGFTH SQYLN Sbjct: 282 WGFTHVSQYLN 292 >ref|XP_022871413.1| oxidation resistance protein 1 isoform X1 [Olea europaea var. sylvestris] Length = 328 Score = 144 bits (364), Expect = 2e-39 Identities = 67/71 (94%), Positives = 67/71 (94%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRYFYLCLND IALGGG NFAL LNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL Sbjct: 258 TGANRYFYLCLNDLIALGGGANFALRLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 317 Query: 181 WGFTHASQYLN 213 WGFTH SQYLN Sbjct: 318 WGFTHVSQYLN 328 >ref|XP_012837029.1| PREDICTED: TLD domain-containing protein 2 isoform X2 [Erythranthe guttata] Length = 289 Score = 142 bits (359), Expect = 4e-39 Identities = 64/71 (90%), Positives = 68/71 (95%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRYFYLCLND +ALGGG +FALCL EDLLSGTSGPCETFG+LCLAHDQEFELKNVEL Sbjct: 219 TGANRYFYLCLNDLLALGGGAHFALCLTEDLLSGTSGPCETFGSLCLAHDQEFELKNVEL 278 Query: 181 WGFTHASQYLN 213 WGFTH+SQYLN Sbjct: 279 WGFTHSSQYLN 289 >gb|PIN09271.1| Oxidation resistance protein [Handroanthus impetiginosus] Length = 339 Score = 142 bits (359), Expect = 1e-38 Identities = 64/71 (90%), Positives = 67/71 (94%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRYFYLCLND +ALGGG NFALCLNEDLLSGTSGPCETFGN CLAHDQEFELKNVEL Sbjct: 269 TGANRYFYLCLNDLLALGGGANFALCLNEDLLSGTSGPCETFGNSCLAHDQEFELKNVEL 328 Query: 181 WGFTHASQYLN 213 WGFTHAS Y++ Sbjct: 329 WGFTHASPYIH 339 >ref|XP_012837028.1| PREDICTED: TLD domain-containing protein 2 isoform X1 [Erythranthe guttata] gb|EYU37771.1| hypothetical protein MIMGU_mgv1a008212mg [Erythranthe guttata] Length = 381 Score = 142 bits (359), Expect = 3e-38 Identities = 64/71 (90%), Positives = 68/71 (95%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRYFYLCLND +ALGGG +FALCL EDLLSGTSGPCETFG+LCLAHDQEFELKNVEL Sbjct: 311 TGANRYFYLCLNDLLALGGGAHFALCLTEDLLSGTSGPCETFGSLCLAHDQEFELKNVEL 370 Query: 181 WGFTHASQYLN 213 WGFTH+SQYLN Sbjct: 371 WGFTHSSQYLN 381 >ref|XP_011088361.1| TLD domain-containing protein 2 [Sesamum indicum] Length = 340 Score = 141 bits (355), Expect = 5e-38 Identities = 62/71 (87%), Positives = 68/71 (95%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRYFYLC+ND +ALGGG NFALCL EDLLSG+SGPCETFGN+CLAHD+EFELKNVEL Sbjct: 270 TGANRYFYLCVNDLLALGGGANFALCLKEDLLSGSSGPCETFGNMCLAHDEEFELKNVEL 329 Query: 181 WGFTHASQYLN 213 WGFTHASQYL+ Sbjct: 330 WGFTHASQYLS 340 >ref|XP_002285459.2| PREDICTED: oxidation resistance protein 1 isoform X1 [Vitis vinifera] emb|CBI23715.3| unnamed protein product, partial [Vitis vinifera] Length = 314 Score = 139 bits (351), Expect = 1e-37 Identities = 63/70 (90%), Positives = 67/70 (95%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRYFYLCLND +ALGGG NFALCL+EDLLSGTSGPCETFGNLCLAH+ EFELKNVEL Sbjct: 244 TGANRYFYLCLNDLLALGGGGNFALCLDEDLLSGTSGPCETFGNLCLAHNPEFELKNVEL 303 Query: 181 WGFTHASQYL 210 WGFTH+SQYL Sbjct: 304 WGFTHSSQYL 313 >gb|ONI26816.1| hypothetical protein PRUPE_1G047600 [Prunus persica] Length = 268 Score = 134 bits (337), Expect = 5e-36 Identities = 59/70 (84%), Positives = 66/70 (94%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRY+Y+CLND +ALGGG N+ALCL+ DLLSGTSGPCETFGNLCLAH+ EFELKNVEL Sbjct: 198 TGANRYYYMCLNDMLALGGGGNYALCLDGDLLSGTSGPCETFGNLCLAHNSEFELKNVEL 257 Query: 181 WGFTHASQYL 210 WGFTHAS+YL Sbjct: 258 WGFTHASRYL 267 >ref|XP_021828989.1| TLD domain-containing protein 2 isoform X2 [Prunus avium] Length = 286 Score = 134 bits (337), Expect = 7e-36 Identities = 59/70 (84%), Positives = 66/70 (94%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRY+Y+CLND +ALGGG N+ALCL+ DLLSGTSGPCETFGNLCLAH+ EFELKNVEL Sbjct: 216 TGANRYYYMCLNDMLALGGGGNYALCLDGDLLSGTSGPCETFGNLCLAHNSEFELKNVEL 275 Query: 181 WGFTHASQYL 210 WGFTHAS+YL Sbjct: 276 WGFTHASRYL 285 >ref|XP_020411452.1| TLD domain-containing protein 2 isoform X2 [Prunus persica] gb|ONI26814.1| hypothetical protein PRUPE_1G047600 [Prunus persica] Length = 286 Score = 134 bits (337), Expect = 7e-36 Identities = 59/70 (84%), Positives = 66/70 (94%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRY+Y+CLND +ALGGG N+ALCL+ DLLSGTSGPCETFGNLCLAH+ EFELKNVEL Sbjct: 216 TGANRYYYMCLNDMLALGGGGNYALCLDGDLLSGTSGPCETFGNLCLAHNSEFELKNVEL 275 Query: 181 WGFTHASQYL 210 WGFTHAS+YL Sbjct: 276 WGFTHASRYL 285 >gb|PHT33026.1| hypothetical protein CQW23_29363 [Capsicum baccatum] Length = 180 Score = 130 bits (328), Expect = 1e-35 Identities = 57/70 (81%), Positives = 65/70 (92%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRYFYLC+N+ +A GGG +FALCL+ DLLSG SGPC+TFGNLCLAHD+EFELKNVEL Sbjct: 109 TGANRYFYLCMNELLAFGGGGHFALCLDGDLLSGNSGPCDTFGNLCLAHDEEFELKNVEL 168 Query: 181 WGFTHASQYL 210 WGFTHAS+YL Sbjct: 169 WGFTHASRYL 178 >ref|XP_009334196.1| PREDICTED: TLD domain-containing protein 2-like isoform X2 [Pyrus x bretschneideri] ref|XP_009334202.1| PREDICTED: TLD domain-containing protein 2-like isoform X2 [Pyrus x bretschneideri] Length = 297 Score = 134 bits (336), Expect = 1e-35 Identities = 59/70 (84%), Positives = 66/70 (94%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRY+Y+CLND +ALGGG N+ALCL+ DLLSGTSGPCETFGNLCLAH+ EFELKNVEL Sbjct: 227 TGANRYYYMCLNDMLALGGGGNYALCLDGDLLSGTSGPCETFGNLCLAHNAEFELKNVEL 286 Query: 181 WGFTHASQYL 210 WGFTHAS+YL Sbjct: 287 WGFTHASRYL 296 >ref|XP_021828988.1| TLD domain-containing protein 2 isoform X1 [Prunus avium] Length = 316 Score = 134 bits (337), Expect = 1e-35 Identities = 59/70 (84%), Positives = 66/70 (94%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRY+Y+CLND +ALGGG N+ALCL+ DLLSGTSGPCETFGNLCLAH+ EFELKNVEL Sbjct: 246 TGANRYYYMCLNDMLALGGGGNYALCLDGDLLSGTSGPCETFGNLCLAHNSEFELKNVEL 305 Query: 181 WGFTHASQYL 210 WGFTHAS+YL Sbjct: 306 WGFTHASRYL 315 >ref|XP_020411451.1| TLD domain-containing protein 2 isoform X1 [Prunus persica] gb|ONI26815.1| hypothetical protein PRUPE_1G047600 [Prunus persica] Length = 316 Score = 134 bits (337), Expect = 1e-35 Identities = 59/70 (84%), Positives = 66/70 (94%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRY+Y+CLND +ALGGG N+ALCL+ DLLSGTSGPCETFGNLCLAH+ EFELKNVEL Sbjct: 246 TGANRYYYMCLNDMLALGGGGNYALCLDGDLLSGTSGPCETFGNLCLAHNSEFELKNVEL 305 Query: 181 WGFTHASQYL 210 WGFTHAS+YL Sbjct: 306 WGFTHASRYL 315 >ref|XP_008245267.1| PREDICTED: TLD domain-containing protein 2 [Prunus mume] Length = 316 Score = 134 bits (337), Expect = 1e-35 Identities = 59/70 (84%), Positives = 66/70 (94%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRY+Y+CLND +ALGGG N+ALCL+ DLLSGTSGPCETFGNLCLAH+ EFELKNVEL Sbjct: 246 TGANRYYYMCLNDMLALGGGGNYALCLDGDLLSGTSGPCETFGNLCLAHNSEFELKNVEL 305 Query: 181 WGFTHASQYL 210 WGFTHAS+YL Sbjct: 306 WGFTHASRYL 315 >ref|XP_010262444.1| PREDICTED: oxidation resistance protein 1-like [Nelumbo nucifera] Length = 304 Score = 133 bits (335), Expect = 2e-35 Identities = 60/70 (85%), Positives = 64/70 (91%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRYFYLCLND +ALGGG NFALCL+EDLL GTSGPCETFGNLCLAH EFELKNVEL Sbjct: 232 TGANRYFYLCLNDLLALGGGGNFALCLDEDLLHGTSGPCETFGNLCLAHSPEFELKNVEL 291 Query: 181 WGFTHASQYL 210 WGF H+S+YL Sbjct: 292 WGFRHSSKYL 301 >ref|XP_024193479.1| oxidation resistance protein 1 isoform X3 [Rosa chinensis] Length = 281 Score = 132 bits (333), Expect = 3e-35 Identities = 59/71 (83%), Positives = 65/71 (91%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRY+Y+CLND +A GGG NFALCL+ DLLSGTSGPCETFGNLCLAH EFELKNVEL Sbjct: 211 TGANRYYYMCLNDLLAFGGGGNFALCLDGDLLSGTSGPCETFGNLCLAHKPEFELKNVEL 270 Query: 181 WGFTHASQYLN 213 WGFTHAS+YL+ Sbjct: 271 WGFTHASRYLS 281 >ref|XP_015162036.1| PREDICTED: oxidation resistance protein 1-like isoform X2 [Solanum tuberosum] Length = 280 Score = 132 bits (332), Expect = 4e-35 Identities = 58/70 (82%), Positives = 66/70 (94%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRYFYLC+N+ +ALGGG +FALCL+ DLLSG SGPC+TFGNLCLAHD+EFELKNVEL Sbjct: 209 TGANRYFYLCMNEILALGGGGHFALCLDGDLLSGNSGPCDTFGNLCLAHDEEFELKNVEL 268 Query: 181 WGFTHASQYL 210 WGFTHAS+YL Sbjct: 269 WGFTHASRYL 278 >ref|XP_007035247.1| PREDICTED: oxidation resistance protein 1 isoform X1 [Theobroma cacao] gb|EOY06173.1| TLD-domain containing nucleolar protein, putative isoform 1 [Theobroma cacao] Length = 335 Score = 133 bits (335), Expect = 4e-35 Identities = 58/69 (84%), Positives = 66/69 (95%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRY+Y+CLND +ALGGG NFALCL+ DLL+GTSGPCETFGNLCLAH+++FELKNVEL Sbjct: 266 TGANRYYYMCLNDLLALGGGGNFALCLDGDLLNGTSGPCETFGNLCLAHNEDFELKNVEL 325 Query: 181 WGFTHASQY 207 WGFTHASQY Sbjct: 326 WGFTHASQY 334 >ref|XP_021290889.1| oxidation resistance protein 1 isoform X2 [Herrania umbratica] Length = 340 Score = 133 bits (335), Expect = 5e-35 Identities = 58/69 (84%), Positives = 66/69 (95%) Frame = +1 Query: 1 TGANRYFYLCLNDSIALGGGTNFALCLNEDLLSGTSGPCETFGNLCLAHDQEFELKNVEL 180 TGANRY+Y+CLND +ALGGG NFALCL+ DLL+GTSGPCETFGNLCLAH+++FELKNVEL Sbjct: 266 TGANRYYYMCLNDLLALGGGGNFALCLDGDLLNGTSGPCETFGNLCLAHNEDFELKNVEL 325 Query: 181 WGFTHASQY 207 WGFTHASQY Sbjct: 326 WGFTHASQY 334