BLASTX nr result
ID: Rehmannia29_contig00023301
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00023301 (413 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011077937.1| uncharacterized protein LOC105161819 isoform... 65 2e-09 ref|XP_011077935.1| uncharacterized protein LOC105161819 isoform... 65 2e-09 ref|XP_020549327.1| uncharacterized protein LOC105161819 isoform... 65 2e-09 ref|XP_020549326.1| uncharacterized protein LOC105161819 isoform... 65 2e-09 gb|PIN14502.1| Spindle pole body protein [Handroanthus impetigin... 64 3e-09 gb|PIN03099.1| Spindle pole body protein [Handroanthus impetigin... 64 3e-09 gb|PIM98263.1| Spindle pole body protein [Handroanthus impetigin... 62 2e-08 gb|KZV42731.1| dentin sialophosphoprotein-like [Dorcoceras hygro... 60 1e-07 gb|EYU41608.1| hypothetical protein MIMGU_mgv1a000472mg [Erythra... 55 5e-06 ref|XP_012831902.1| PREDICTED: uncharacterized protein LOC105952... 55 5e-06 >ref|XP_011077937.1| uncharacterized protein LOC105161819 isoform X4 [Sesamum indicum] Length = 976 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 17 SALNKTSSNKDESAKKASHVHPKLPDYDTLFQSLRMNRS 133 + LNK+SSNKD+S +KASHVHPKLPDYD L QSLR NRS Sbjct: 938 ATLNKSSSNKDDSNQKASHVHPKLPDYDALVQSLRKNRS 976 >ref|XP_011077935.1| uncharacterized protein LOC105161819 isoform X3 [Sesamum indicum] Length = 1077 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 17 SALNKTSSNKDESAKKASHVHPKLPDYDTLFQSLRMNRS 133 + LNK+SSNKD+S +KASHVHPKLPDYD L QSLR NRS Sbjct: 1039 ATLNKSSSNKDDSNQKASHVHPKLPDYDALVQSLRKNRS 1077 >ref|XP_020549327.1| uncharacterized protein LOC105161819 isoform X2 [Sesamum indicum] Length = 1100 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 17 SALNKTSSNKDESAKKASHVHPKLPDYDTLFQSLRMNRS 133 + LNK+SSNKD+S +KASHVHPKLPDYD L QSLR NRS Sbjct: 1062 ATLNKSSSNKDDSNQKASHVHPKLPDYDALVQSLRKNRS 1100 >ref|XP_020549326.1| uncharacterized protein LOC105161819 isoform X1 [Sesamum indicum] Length = 1102 Score = 65.1 bits (157), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = +2 Query: 17 SALNKTSSNKDESAKKASHVHPKLPDYDTLFQSLRMNRS 133 + LNK+SSNKD+S +KASHVHPKLPDYD L QSLR NRS Sbjct: 1064 ATLNKSSSNKDDSNQKASHVHPKLPDYDALVQSLRKNRS 1102 >gb|PIN14502.1| Spindle pole body protein [Handroanthus impetiginosus] Length = 1154 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 23 LNKTSSNKDESAKKASHVHPKLPDYDTLFQSLRMNRS 133 L+ TSSNKD+ K+ASHVHPKLPDYDTLF SLR NRS Sbjct: 1118 LDNTSSNKDDGVKRASHVHPKLPDYDTLFASLRKNRS 1154 >gb|PIN03099.1| Spindle pole body protein [Handroanthus impetiginosus] Length = 1154 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/37 (78%), Positives = 32/37 (86%) Frame = +2 Query: 23 LNKTSSNKDESAKKASHVHPKLPDYDTLFQSLRMNRS 133 L+ TSSNKD+ K+ASHVHPKLPDYDTLF SLR NRS Sbjct: 1118 LDNTSSNKDDGVKRASHVHPKLPDYDTLFASLRKNRS 1154 >gb|PIM98263.1| Spindle pole body protein [Handroanthus impetiginosus] Length = 1053 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = +2 Query: 2 ENRNESALNKTSSNKDESAKKASHVHPKLPDYDTLFQSLRMNRS 133 EN + NKT SNKD+ +KASHVHPKLPDYDTL Q+LR RS Sbjct: 1010 ENHKAATPNKTPSNKDDRNQKASHVHPKLPDYDTLVQTLRQYRS 1053 >gb|KZV42731.1| dentin sialophosphoprotein-like [Dorcoceras hygrometricum] Length = 1304 Score = 59.7 bits (143), Expect = 1e-07 Identities = 26/43 (60%), Positives = 32/43 (74%) Frame = +2 Query: 2 ENRNESALNKTSSNKDESAKKASHVHPKLPDYDTLFQSLRMNR 130 EN + LNKT+SNK + +KASHVHPKLPDYD+ Q+ R NR Sbjct: 1259 ENPKTATLNKTNSNKRDGTQKASHVHPKLPDYDSFIQAFRKNR 1301 >gb|EYU41608.1| hypothetical protein MIMGU_mgv1a000472mg [Erythranthe guttata] Length = 1130 Score = 55.1 bits (131), Expect = 5e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +2 Query: 35 SSNKDESAKKASHVHPKLPDYDTLFQSLRMNR 130 S K + AKKASHVHPKLPDYDTLF++LR NR Sbjct: 1098 SPGKQDGAKKASHVHPKLPDYDTLFETLRANR 1129 >ref|XP_012831902.1| PREDICTED: uncharacterized protein LOC105952865 [Erythranthe guttata] Length = 1215 Score = 55.1 bits (131), Expect = 5e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = +2 Query: 35 SSNKDESAKKASHVHPKLPDYDTLFQSLRMNR 130 S K + AKKASHVHPKLPDYDTLF++LR NR Sbjct: 1183 SPGKQDGAKKASHVHPKLPDYDTLFETLRANR 1214