BLASTX nr result
ID: Rehmannia29_contig00023240
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00023240 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28193.1| hypothetical protein MIMGU_mgv1a008794mg [Erythra... 62 2e-08 ref|XP_012849082.1| PREDICTED: tobamovirus multiplication protei... 57 8e-07 >gb|EYU28193.1| hypothetical protein MIMGU_mgv1a008794mg [Erythranthe guttata] Length = 362 Score = 62.0 bits (149), Expect = 2e-08 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = +1 Query: 1 RQQESRTITFISDGSVPTHPQRWIAATSVQNQVVMLLSVN 120 RQ+ESRTITF+SD V THPQRW AATSVQNQV++LL ++ Sbjct: 316 RQEESRTITFMSDVPVATHPQRWTAATSVQNQVLLLLRLS 355 >ref|XP_012849082.1| PREDICTED: tobamovirus multiplication protein 1-like isoform X1 [Erythranthe guttata] ref|XP_012849083.1| PREDICTED: tobamovirus multiplication protein 1-like isoform X2 [Erythranthe guttata] Length = 354 Score = 57.4 bits (137), Expect = 8e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = +1 Query: 1 RQQESRTITFISDGSVPTHPQRWIAATSVQNQV 99 RQ+ESRTITF+SD V THPQRW AATSVQNQV Sbjct: 316 RQEESRTITFMSDVPVATHPQRWTAATSVQNQV 348