BLASTX nr result
ID: Rehmannia29_contig00023158
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00023158 (644 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN20987.1| hypothetical protein CDL12_06321 [Handroanthus im... 66 5e-11 >gb|PIN20987.1| hypothetical protein CDL12_06321 [Handroanthus impetiginosus] Length = 59 Score = 65.9 bits (159), Expect = 5e-11 Identities = 33/40 (82%), Positives = 35/40 (87%) Frame = +2 Query: 134 MIKVGKMVELMEEYSLIMARMREELYFLPRRVDFQFLRTL 253 MIKVGKMVELM+EYSLIMARMRE+LYFL R DFQ RTL Sbjct: 1 MIKVGKMVELMKEYSLIMARMREQLYFLRRPSDFQLFRTL 40