BLASTX nr result
ID: Rehmannia29_contig00023121
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00023121 (1051 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020989329.1| chloroplastic group IIB intron splicing faci... 69 1e-09 ref|XP_020989328.1| chloroplastic group IIB intron splicing faci... 69 2e-09 gb|KRH39021.1| hypothetical protein GLYMA_09G172400 [Glycine max] 64 3e-09 ref|XP_020223908.1| chloroplastic group IIB intron splicing faci... 67 4e-09 ref|XP_007139170.1| hypothetical protein PHAVU_008G007300g [Phas... 67 4e-09 gb|KJB10454.1| hypothetical protein B456_001G202300 [Gossypium r... 65 4e-09 ref|XP_016180129.1| chloroplastic group IIB intron splicing faci... 67 5e-09 dbj|GAU37788.1| hypothetical protein TSUD_158690 [Trifolium subt... 65 7e-09 ref|XP_017409030.1| PREDICTED: chloroplastic group IIB intron sp... 66 9e-09 ref|XP_014497004.1| chloroplastic group IIB intron splicing faci... 66 9e-09 ref|XP_017409028.1| PREDICTED: chloroplastic group IIB intron sp... 66 9e-09 ref|XP_014497003.1| chloroplastic group IIB intron splicing faci... 66 9e-09 ref|XP_022635834.1| chloroplastic group IIB intron splicing faci... 66 9e-09 gb|KOM28513.1| hypothetical protein LR48_Vigan549s006800 [Vigna ... 66 9e-09 ref|NP_001239818.1| uncharacterized protein LOC100804132 [Glycin... 66 1e-08 gb|OTG07456.1| putative peptidyl-tRNA hydrolase [Helianthus annuus] 64 1e-08 gb|ONI17189.1| hypothetical protein PRUPE_3G143700 [Prunus persica] 64 2e-08 gb|PPD79448.1| hypothetical protein GOBAR_DD23628 [Gossypium bar... 65 2e-08 gb|ACU17427.1| unknown, partial [Glycine max] 64 2e-08 ref|XP_022884355.1| chloroplastic group IIB intron splicing faci... 65 2e-08 >ref|XP_020989329.1| chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic isoform X3 [Arachis duranensis] Length = 242 Score = 68.6 bits (166), Expect = 1e-09 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = -3 Query: 206 VSLHNL-SFLDHNYLIKYLFSLSITRFGPLAVYYQASLRHILLVYDETSLPNGVLRLHPK 30 +S H L F+ + ++ +L L + GPLA YYQ LRHILLVYDE SLPNGVLRL PK Sbjct: 128 ISSHKLLDFIRYTHV--HLVKLVTNQVGPLAAYYQVPLRHILLVYDEMSLPNGVLRLQPK 185 Query: 29 GG 24 GG Sbjct: 186 GG 187 >ref|XP_020989328.1| chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic isoform X1 [Arachis duranensis] Length = 276 Score = 68.6 bits (166), Expect = 2e-09 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = -3 Query: 206 VSLHNL-SFLDHNYLIKYLFSLSITRFGPLAVYYQASLRHILLVYDETSLPNGVLRLHPK 30 +S H L F+ + ++ +L L + GPLA YYQ LRHILLVYDE SLPNGVLRL PK Sbjct: 128 ISSHKLLDFIRYTHV--HLVKLVTNQVGPLAAYYQVPLRHILLVYDEMSLPNGVLRLQPK 185 Query: 29 GG 24 GG Sbjct: 186 GG 187 >gb|KRH39021.1| hypothetical protein GLYMA_09G172400 [Glycine max] Length = 100 Score = 64.3 bits (155), Expect = 3e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ RHILLV+DETSLPNGVLRL PKGG Sbjct: 31 GPLAAYYQVPFRHILLVFDETSLPNGVLRLQPKGG 65 >ref|XP_020223908.1| chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic [Cajanus cajan] ref|XP_020223909.1| chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic [Cajanus cajan] gb|KYP59455.1| hypothetical protein KK1_014891 [Cajanus cajan] Length = 247 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILLVYDETSLPNGVLRL PKGG Sbjct: 124 GPLAAYYQVPLRHILLVYDETSLPNGVLRLQPKGG 158 >ref|XP_007139170.1| hypothetical protein PHAVU_008G007300g [Phaseolus vulgaris] gb|ESW11164.1| hypothetical protein PHAVU_008G007300g [Phaseolus vulgaris] Length = 247 Score = 67.4 bits (163), Expect = 4e-09 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILLVYDETSLPNGVLRL PKGG Sbjct: 124 GPLAAYYQVPLRHILLVYDETSLPNGVLRLQPKGG 158 >gb|KJB10454.1| hypothetical protein B456_001G202300 [Gossypium raimondii] Length = 132 Score = 64.7 bits (156), Expect = 4e-09 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILL+YDE SLPNGVLRL PKGG Sbjct: 9 GPLAAYYQVPLRHILLIYDEMSLPNGVLRLQPKGG 43 >ref|XP_016180129.1| chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic [Arachis ipaensis] Length = 249 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ SLRHILLVYDE SLPNGVLRL PKGG Sbjct: 126 GPLATYYQVSLRHILLVYDEMSLPNGVLRLQPKGG 160 >dbj|GAU37788.1| hypothetical protein TSUD_158690 [Trifolium subterraneum] Length = 160 Score = 64.7 bits (156), Expect = 7e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YY+ LRHILLVYDETSLPNGVL+L PKGG Sbjct: 37 GPLAAYYRVPLRHILLVYDETSLPNGVLKLQPKGG 71 >ref|XP_017409030.1| PREDICTED: chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic isoform X2 [Vigna angularis] dbj|BAT82992.1| hypothetical protein VIGAN_04008400 [Vigna angularis var. angularis] Length = 247 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILLVYDETSLPNGVL+L PKGG Sbjct: 124 GPLAAYYQVPLRHILLVYDETSLPNGVLKLQPKGG 158 >ref|XP_014497004.1| chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic isoform X3 [Vigna radiata var. radiata] ref|XP_014497005.1| chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic isoform X3 [Vigna radiata var. radiata] ref|XP_022635836.1| chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic isoform X3 [Vigna radiata var. radiata] Length = 247 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILLVYDETSLPNGVL+L PKGG Sbjct: 124 GPLAAYYQVPLRHILLVYDETSLPNGVLKLQPKGG 158 >ref|XP_017409028.1| PREDICTED: chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic isoform X1 [Vigna angularis] ref|XP_017409029.1| PREDICTED: chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic isoform X1 [Vigna angularis] Length = 251 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILLVYDETSLPNGVL+L PKGG Sbjct: 128 GPLAAYYQVPLRHILLVYDETSLPNGVLKLQPKGG 162 >ref|XP_014497003.1| chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic isoform X2 [Vigna radiata var. radiata] Length = 251 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILLVYDETSLPNGVL+L PKGG Sbjct: 128 GPLAAYYQVPLRHILLVYDETSLPNGVLKLQPKGG 162 >ref|XP_022635834.1| chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic isoform X1 [Vigna radiata var. radiata] Length = 252 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILLVYDETSLPNGVL+L PKGG Sbjct: 129 GPLAAYYQVPLRHILLVYDETSLPNGVLKLQPKGG 163 >gb|KOM28513.1| hypothetical protein LR48_Vigan549s006800 [Vigna angularis] Length = 252 Score = 66.2 bits (160), Expect = 9e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILLVYDETSLPNGVL+L PKGG Sbjct: 129 GPLAAYYQVPLRHILLVYDETSLPNGVLKLQPKGG 163 >ref|NP_001239818.1| uncharacterized protein LOC100804132 [Glycine max] gb|ACU23247.1| unknown [Glycine max] gb|KRH01735.1| hypothetical protein GLYMA_18G295600 [Glycine max] Length = 244 Score = 65.9 bits (159), Expect = 1e-08 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILLV+DETSLPNGVLRL PKGG Sbjct: 121 GPLAAYYQVPLRHILLVFDETSLPNGVLRLQPKGG 155 >gb|OTG07456.1| putative peptidyl-tRNA hydrolase [Helianthus annuus] Length = 160 Score = 63.9 bits (154), Expect = 1e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILLVYDE SLPNGVLRL P+GG Sbjct: 37 GPLAAYYQVPLRHILLVYDEMSLPNGVLRLQPRGG 71 >gb|ONI17189.1| hypothetical protein PRUPE_3G143700 [Prunus persica] Length = 187 Score = 64.3 bits (155), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILLVYDE SLPNGVLR+ PKGG Sbjct: 124 GPLAAYYQVPLRHILLVYDEMSLPNGVLRIQPKGG 158 >gb|PPD79448.1| hypothetical protein GOBAR_DD23628 [Gossypium barbadense] Length = 210 Score = 64.7 bits (156), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILL+YDE SLPNGVLRL PKGG Sbjct: 87 GPLAAYYQVPLRHILLIYDEMSLPNGVLRLQPKGG 121 >gb|ACU17427.1| unknown, partial [Glycine max] Length = 179 Score = 63.9 bits (154), Expect = 2e-08 Identities = 29/35 (82%), Positives = 30/35 (85%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILLV+DETSLPNGVLRL P GG Sbjct: 121 GPLAAYYQVPLRHILLVFDETSLPNGVLRLQPNGG 155 >ref|XP_022884355.1| chloroplastic group IIB intron splicing facilitator CRS2-B, chloroplastic isoform X3 [Olea europaea var. sylvestris] Length = 239 Score = 65.1 bits (157), Expect = 2e-08 Identities = 30/35 (85%), Positives = 30/35 (85%) Frame = -3 Query: 128 GPLAVYYQASLRHILLVYDETSLPNGVLRLHPKGG 24 GPLA YYQ LRHILLVYDE SLPNGVLRL PKGG Sbjct: 125 GPLAAYYQVPLRHILLVYDEMSLPNGVLRLQPKGG 159