BLASTX nr result
ID: Rehmannia29_contig00022958
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00022958 (733 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|GAU10062.1| hypothetical protein TSUD_423020, partial [Trifo... 59 1e-06 gb|PNY13664.1| receptor-like protein kinase [Trifolium pratense] 59 2e-06 >dbj|GAU10062.1| hypothetical protein TSUD_423020, partial [Trifolium subterraneum] Length = 305 Score = 59.3 bits (142), Expect = 1e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 108 LVCFSRFPNGPTITTEKLNGKNYLNWHSSVELWFLG 1 L+ F+ F P ITTEKLNGKNYLNWHSSVE+WFLG Sbjct: 72 LISFA-FHGTPIITTEKLNGKNYLNWHSSVEIWFLG 106 >gb|PNY13664.1| receptor-like protein kinase [Trifolium pratense] Length = 997 Score = 59.3 bits (142), Expect = 2e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -2 Query: 108 LVCFSRFPNGPTITTEKLNGKNYLNWHSSVELWFLG 1 L+ F+ F P ITTEKLNGKNYLNWHSSVE+WFLG Sbjct: 16 LISFA-FHGTPIITTEKLNGKNYLNWHSSVEIWFLG 50