BLASTX nr result
ID: Rehmannia29_contig00022569
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00022569 (977 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020552412.1| GATA transcription factor 11-like [Sesamum i... 90 2e-16 gb|PIN15057.1| hypothetical protein CDL12_12320 [Handroanthus im... 87 1e-15 ref|XP_015058777.1| PREDICTED: GATA transcription factor 11 [Sol... 70 6e-10 ref|XP_004251141.1| PREDICTED: GATA transcription factor 11-like... 70 6e-10 ref|XP_006340186.1| PREDICTED: GATA transcription factor 11-like... 70 6e-10 ref|XP_019066596.1| PREDICTED: GATA transcription factor 8-like ... 69 1e-09 emb|CDP07101.1| unnamed protein product [Coffea canephora] 69 1e-09 ref|XP_019166505.1| PREDICTED: GATA transcription factor 11-like... 69 1e-09 ref|XP_019178239.1| PREDICTED: GATA transcription factor 11-like... 69 2e-09 ref|XP_019240882.1| PREDICTED: GATA transcription factor 11-like... 65 2e-08 ref|NP_001313191.1| GATA transcription factor 11-like [Nicotiana... 65 2e-08 ref|XP_009795846.1| PREDICTED: GATA transcription factor 11-like... 65 2e-08 ref|XP_009621794.1| PREDICTED: GATA transcription factor 11-like... 65 2e-08 ref|XP_019240881.1| PREDICTED: GATA transcription factor 11-like... 65 2e-08 ref|XP_009795845.1| PREDICTED: GATA transcription factor 11-like... 65 2e-08 ref|XP_009621793.1| PREDICTED: GATA transcription factor 11-like... 65 2e-08 ref|XP_011089920.1| GATA transcription factor 11 isoform X2 [Ses... 61 7e-07 gb|PHT35148.1| GATA transcription factor 8 [Capsicum baccatum] 61 7e-07 ref|XP_011089919.1| GATA transcription factor 11 isoform X1 [Ses... 61 8e-07 gb|PHU03871.1| GATA transcription factor 8 [Capsicum chinense] 61 1e-06 >ref|XP_020552412.1| GATA transcription factor 11-like [Sesamum indicum] Length = 360 Score = 89.7 bits (221), Expect = 2e-16 Identities = 42/64 (65%), Positives = 51/64 (79%) Frame = +2 Query: 782 HIIRPNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGL 961 H+++ NKF + QES FQTQSPVSVLE+ GS SA K+LPI SHN IPVR RSKR++ G+ Sbjct: 131 HMLQQNKFVDVQESGFFQTQSPVSVLESGGSCSAGKNLPIKSHNAIPVRTRSKRVRHAGI 190 Query: 962 NPWL 973 NPWL Sbjct: 191 NPWL 194 >gb|PIN15057.1| hypothetical protein CDL12_12320 [Handroanthus impetiginosus] Length = 326 Score = 87.0 bits (214), Expect = 1e-15 Identities = 45/64 (70%), Positives = 48/64 (75%) Frame = +2 Query: 782 HIIRPNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGL 961 HI NK SE QESS FQTQSPVSVLE+SGS S KSLPI S IPVR RSKR++P G Sbjct: 107 HINLQNKPSEVQESSGFQTQSPVSVLESSGSCSVAKSLPIKSQKAIPVRTRSKRIRPTGA 166 Query: 962 NPWL 973 NPWL Sbjct: 167 NPWL 170 >ref|XP_015058777.1| PREDICTED: GATA transcription factor 11 [Solanum pennellii] Length = 336 Score = 70.5 bits (171), Expect = 6e-10 Identities = 35/60 (58%), Positives = 41/60 (68%) Frame = +2 Query: 794 PNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLNPWL 973 P KF+E Q + FQTQSPVSVLE S S S KS+PI IPVR RSKR +P +NPW+ Sbjct: 89 PIKFTEVQGTGTFQTQSPVSVLEGSNSCSGGKSVPIKHDPVIPVRPRSKRARPSAVNPWV 148 >ref|XP_004251141.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Solanum lycopersicum] Length = 336 Score = 70.5 bits (171), Expect = 6e-10 Identities = 35/60 (58%), Positives = 41/60 (68%) Frame = +2 Query: 794 PNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLNPWL 973 P KF+E Q + FQTQSPVSVLE S S S KS+PI IPVR RSKR +P +NPW+ Sbjct: 89 PIKFTEVQGTGTFQTQSPVSVLEGSNSCSGGKSVPIKHDPVIPVRPRSKRARPSAVNPWV 148 >ref|XP_006340186.1| PREDICTED: GATA transcription factor 11-like [Solanum tuberosum] Length = 337 Score = 70.5 bits (171), Expect = 6e-10 Identities = 35/60 (58%), Positives = 41/60 (68%) Frame = +2 Query: 794 PNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLNPWL 973 P KF+E Q + FQTQSPVSVLE S S S KS+PI IPVR RSKR +P +NPW+ Sbjct: 91 PIKFTEVQGTGTFQTQSPVSVLEGSNSCSGGKSIPIKHDIVIPVRPRSKRARPSAVNPWV 150 >ref|XP_019066596.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum lycopersicum] Length = 272 Score = 68.9 bits (167), Expect = 1e-09 Identities = 34/58 (58%), Positives = 40/58 (68%) Frame = +2 Query: 800 KFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLNPWL 973 KF+E Q + FQTQSPVSVLE S S S KS+PI IPVR RSKR +P +NPW+ Sbjct: 27 KFTEVQGTGTFQTQSPVSVLEGSNSCSGGKSVPIKHDPVIPVRPRSKRARPSAVNPWV 84 >emb|CDP07101.1| unnamed protein product [Coffea canephora] Length = 316 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/55 (63%), Positives = 38/55 (69%) Frame = +2 Query: 806 SEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLNPW 970 SE QES FQT SPVSVLE+ GS S KSLPI IPVR RSKR +P +NPW Sbjct: 116 SEGQESGSFQTHSPVSVLESGGSCSGGKSLPIKPDIVIPVRTRSKRARPSAINPW 170 >ref|XP_019166505.1| PREDICTED: GATA transcription factor 11-like [Ipomoea nil] Length = 326 Score = 69.3 bits (168), Expect = 1e-09 Identities = 35/63 (55%), Positives = 46/63 (73%) Frame = +2 Query: 785 IIRPNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLN 964 ++ P+K+ +AQ+ VFQTQSPVSVLE S S S K++PI S IPVR RSKR +P +N Sbjct: 108 LLYPSKYFDAQQPGVFQTQSPVSVLETSISYSGGKTVPIKSDITIPVRTRSKRARP-AVN 166 Query: 965 PWL 973 PW+ Sbjct: 167 PWI 169 >ref|XP_019178239.1| PREDICTED: GATA transcription factor 11-like [Ipomoea nil] Length = 324 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/59 (55%), Positives = 45/59 (76%) Frame = +2 Query: 797 NKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLNPWL 973 NK+S+AQE+ +FQTQSPVSVLE+S S S K++P+ + +PVR R+KR +P NPWL Sbjct: 103 NKYSDAQEAVMFQTQSPVSVLESSASCSGGKAIPVKTGVAVPVRTRTKRTRP-STNPWL 160 >ref|XP_019240882.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana attenuata] Length = 305 Score = 65.5 bits (158), Expect = 2e-08 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = +2 Query: 794 PNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLNPWL 973 P K +E Q S +FQTQSPVSVLE+S S S KS+ I IPVR RSKR + LNPW+ Sbjct: 88 PIKVTEGQGSGIFQTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWI 147 >ref|NP_001313191.1| GATA transcription factor 11-like [Nicotiana tabacum] emb|CAC28528.1| GATA-1 zinc finger protein [Nicotiana tabacum] Length = 305 Score = 65.5 bits (158), Expect = 2e-08 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = +2 Query: 794 PNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLNPWL 973 P K +E Q S +FQTQSPVSVLE+S S S KS+ I IPVR RSKR + LNPW+ Sbjct: 88 PIKVTEGQGSGIFQTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWI 147 >ref|XP_009795846.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana sylvestris] Length = 305 Score = 65.5 bits (158), Expect = 2e-08 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = +2 Query: 794 PNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLNPWL 973 P K +E Q S +FQTQSPVSVLE+S S S KS+ I IPVR RSKR + LNPW+ Sbjct: 88 PIKVTEGQGSGIFQTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWI 147 >ref|XP_009621794.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana tomentosiformis] ref|XP_016465978.1| PREDICTED: GATA transcription factor 11-like isoform X2 [Nicotiana tabacum] Length = 305 Score = 65.5 bits (158), Expect = 2e-08 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = +2 Query: 794 PNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLNPWL 973 P K +E Q S +FQTQSPVSVLE+S S S KS+ I IPVR RSKR + LNPW+ Sbjct: 88 PIKVTEGQGSGIFQTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWI 147 >ref|XP_019240881.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana attenuata] gb|OIT19906.1| gata transcription factor 11 [Nicotiana attenuata] Length = 306 Score = 65.5 bits (158), Expect = 2e-08 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = +2 Query: 794 PNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLNPWL 973 P K +E Q S +FQTQSPVSVLE+S S S KS+ I IPVR RSKR + LNPW+ Sbjct: 89 PIKVTEGQGSGIFQTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWI 148 >ref|XP_009795845.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana sylvestris] ref|XP_016514725.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana tabacum] Length = 306 Score = 65.5 bits (158), Expect = 2e-08 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = +2 Query: 794 PNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLNPWL 973 P K +E Q S +FQTQSPVSVLE+S S S KS+ I IPVR RSKR + LNPW+ Sbjct: 89 PIKVTEGQGSGIFQTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWI 148 >ref|XP_009621793.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana tomentosiformis] ref|XP_016465977.1| PREDICTED: GATA transcription factor 11-like isoform X1 [Nicotiana tabacum] Length = 306 Score = 65.5 bits (158), Expect = 2e-08 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = +2 Query: 794 PNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLNPWL 973 P K +E Q S +FQTQSPVSVLE+S S S KS+ I IPVR RSKR + LNPW+ Sbjct: 89 PIKVTEGQGSGIFQTQSPVSVLESSNSCSGGKSISIKHDIAIPVRPRSKRPRSSALNPWI 148 >ref|XP_011089920.1| GATA transcription factor 11 isoform X2 [Sesamum indicum] Length = 335 Score = 61.2 bits (147), Expect = 7e-07 Identities = 35/63 (55%), Positives = 42/63 (66%) Frame = +2 Query: 785 IIRPNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLN 964 I R N ++E QE VF+TQSP+SVLENSGS A KS I H R RSKR +P G++ Sbjct: 108 IRRQNTYTEVQEQGVFRTQSPISVLENSGS-LAGKSPLIKRHT--GKRTRSKRARPSGVS 164 Query: 965 PWL 973 PWL Sbjct: 165 PWL 167 >gb|PHT35148.1| GATA transcription factor 8 [Capsicum baccatum] Length = 337 Score = 61.2 bits (147), Expect = 7e-07 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 4/62 (6%) Frame = +2 Query: 800 KFSEAQESS-VFQTQSPVSVLENSGSRSAEKSLPIN--SHNP-IPVRARSKRLKPMGLNP 967 KF+E Q ++ FQTQSPVSVLE S S S KS+PI H+ IPVR RSKR +P +NP Sbjct: 89 KFTEVQGTTGTFQTQSPVSVLEGSNSCSGGKSIPIKPIKHDTVIPVRPRSKRARPSAVNP 148 Query: 968 WL 973 W+ Sbjct: 149 WI 150 >ref|XP_011089919.1| GATA transcription factor 11 isoform X1 [Sesamum indicum] Length = 353 Score = 61.2 bits (147), Expect = 8e-07 Identities = 35/63 (55%), Positives = 42/63 (66%) Frame = +2 Query: 785 IIRPNKFSEAQESSVFQTQSPVSVLENSGSRSAEKSLPINSHNPIPVRARSKRLKPMGLN 964 I R N ++E QE VF+TQSP+SVLENSGS A KS I H R RSKR +P G++ Sbjct: 126 IRRQNTYTEVQEQGVFRTQSPISVLENSGS-LAGKSPLIKRHT--GKRTRSKRARPSGVS 182 Query: 965 PWL 973 PWL Sbjct: 183 PWL 185 >gb|PHU03871.1| GATA transcription factor 8 [Capsicum chinense] Length = 337 Score = 60.8 bits (146), Expect = 1e-06 Identities = 35/62 (56%), Positives = 43/62 (69%), Gaps = 4/62 (6%) Frame = +2 Query: 800 KFSEAQESS-VFQTQSPVSVLENSGSRSAEKSLPIN--SHNP-IPVRARSKRLKPMGLNP 967 KF+E Q ++ FQTQSPVSVLE S S S KS+PI H+ IPVR RSKR +P +NP Sbjct: 89 KFTEVQGTTGTFQTQSPVSVLEGSNSCSGGKSIPIKPIKHDTVIPVRPRSKRARPSAVNP 148 Query: 968 WL 973 W+ Sbjct: 149 WV 150