BLASTX nr result
ID: Rehmannia29_contig00022540
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00022540 (465 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU41703.1| hypothetical protein MIMGU_mgv1a010276mg [Erythra... 61 6e-08 ref|XP_012831991.1| PREDICTED: short-chain dehydrogenase TIC 32,... 61 6e-08 ref|XP_011094836.1| short-chain dehydrogenase TIC 32, chloroplas... 59 2e-07 ref|XP_011077448.1| short-chain dehydrogenase TIC 32, chloroplas... 58 7e-07 gb|KZV06897.1| short-chain dehydrogenase TIC 32, chloroplastic-l... 54 1e-06 gb|PIN11207.1| NADP-retinol dehydrogenase [Handroanthus impetigi... 54 8e-06 gb|PIA38998.1| hypothetical protein AQUCO_02700287v1 [Aquilegia ... 55 9e-06 gb|KZV13816.1| short-chain dehydrogenase TIC 32, chloroplastic [... 54 1e-05 >gb|EYU41703.1| hypothetical protein MIMGU_mgv1a010276mg [Erythranthe guttata] Length = 317 Score = 60.8 bits (146), Expect = 6e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 2 DCNEFKPSRLARKEVLAKKLWEFSTKLVNEAENS 103 DCNE KPSR+AR EVLAKKLWEFS KLVN A+NS Sbjct: 284 DCNESKPSRMARDEVLAKKLWEFSNKLVNAAQNS 317 >ref|XP_012831991.1| PREDICTED: short-chain dehydrogenase TIC 32, chloroplastic [Erythranthe guttata] Length = 321 Score = 60.8 bits (146), Expect = 6e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = +2 Query: 2 DCNEFKPSRLARKEVLAKKLWEFSTKLVNEAENS 103 DCNE KPSR+AR EVLAKKLWEFS KLVN A+NS Sbjct: 288 DCNESKPSRMARDEVLAKKLWEFSNKLVNAAQNS 321 >ref|XP_011094836.1| short-chain dehydrogenase TIC 32, chloroplastic [Sesamum indicum] Length = 320 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +2 Query: 2 DCNEFKPSRLARKEVLAKKLWEFSTKLVNEAENS 103 DCNEFKPSR AR EVLAK+LW+FS KLVN AE S Sbjct: 287 DCNEFKPSRFARNEVLAKRLWDFSNKLVNAAEAS 320 >ref|XP_011077448.1| short-chain dehydrogenase TIC 32, chloroplastic-like [Sesamum indicum] Length = 320 Score = 57.8 bits (138), Expect = 7e-07 Identities = 25/34 (73%), Positives = 31/34 (91%) Frame = +2 Query: 2 DCNEFKPSRLARKEVLAKKLWEFSTKLVNEAENS 103 DCN+FKPSR+AR EVLAK+LW+FS KLV+EAE + Sbjct: 287 DCNKFKPSRVARSEVLAKRLWDFSCKLVDEAEKA 320 >gb|KZV06897.1| short-chain dehydrogenase TIC 32, chloroplastic-like [Dorcoceras hygrometricum] Length = 89 Score = 53.9 bits (128), Expect = 1e-06 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +2 Query: 2 DCNEFKPSRLARKEVLAKKLWEFSTKLVNEAE 97 DCNEFKPS AR E+LAK+LW+FS K++N AE Sbjct: 52 DCNEFKPSAYARDEILAKRLWDFSNKIINAAE 83 >gb|PIN11207.1| NADP-retinol dehydrogenase [Handroanthus impetiginosus] Length = 200 Score = 53.9 bits (128), Expect = 8e-06 Identities = 23/32 (71%), Positives = 28/32 (87%) Frame = +2 Query: 2 DCNEFKPSRLARKEVLAKKLWEFSTKLVNEAE 97 DCNEF+PSR AR ++LAK+LW+FS KLVN AE Sbjct: 167 DCNEFEPSRFARNKILAKELWDFSYKLVNAAE 198 >gb|PIA38998.1| hypothetical protein AQUCO_02700287v1 [Aquilegia coerulea] Length = 326 Score = 54.7 bits (130), Expect = 9e-06 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = +2 Query: 2 DCNEFKPSRLARKEVLAKKLWEFSTKLVNEA 94 +CNEFKPS+LA EVLAKKLW+FS KLVN A Sbjct: 292 ECNEFKPSKLAANEVLAKKLWDFSNKLVNSA 322 >gb|KZV13816.1| short-chain dehydrogenase TIC 32, chloroplastic [Dorcoceras hygrometricum] gb|KZV53389.1| short-chain dehydrogenase TIC 32, chloroplastic [Dorcoceras hygrometricum] Length = 216 Score = 53.9 bits (128), Expect = 1e-05 Identities = 22/32 (68%), Positives = 27/32 (84%) Frame = +2 Query: 2 DCNEFKPSRLARKEVLAKKLWEFSTKLVNEAE 97 DCNEFKPS AR E+LAK+LW+FS K++N AE Sbjct: 179 DCNEFKPSAYARDEILAKRLWDFSNKIINAAE 210