BLASTX nr result
ID: Rehmannia29_contig00022531
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00022531 (736 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080467.1| L-ascorbate oxidase [Sesamum indicum] 107 5e-23 gb|KVG89796.1| Cupredoxin [Cynara cardunculus var. scolymus] 105 4e-22 ref|XP_021993780.1| L-ascorbate oxidase-like [Helianthus annuus]... 103 2e-21 ref|XP_016456940.1| PREDICTED: L-ascorbate oxidase-like [Nicotia... 102 4e-21 ref|XP_009763033.1| PREDICTED: L-ascorbate oxidase isoform X2 [N... 102 4e-21 emb|CDN40973.1| Ascorbate oxidase [Nicotiana benthamiana] 102 4e-21 ref|XP_010251700.1| PREDICTED: L-ascorbate oxidase-like [Nelumbo... 102 4e-21 ref|XP_009763032.1| PREDICTED: L-ascorbate oxidase isoform X1 [N... 102 5e-21 ref|NP_001313101.1| L-ascorbate oxidase precursor [Nicotiana tab... 102 5e-21 ref|XP_010535760.1| PREDICTED: L-ascorbate oxidase-like [Tarenay... 101 6e-21 gb|PHU03145.1| L-ascorbate oxidase [Capsicum chinense] 96 7e-21 ref|XP_024018277.1| L-ascorbate oxidase-like, partial [Morus not... 99 9e-21 ref|XP_020878847.1| L-ascorbate oxidase [Arabidopsis lyrata subs... 100 2e-20 ref|XP_019235254.1| PREDICTED: L-ascorbate oxidase [Nicotiana at... 100 2e-20 gb|PLY98506.1| hypothetical protein LSAT_7X77240 [Lactuca sativa] 100 2e-20 ref|XP_023762733.1| L-ascorbate oxidase-like [Lactuca sativa] 100 2e-20 gb|PHT68489.1| hypothetical protein T459_27976 [Capsicum annuum] 93 3e-20 ref|XP_024019721.1| L-ascorbate oxidase [Morus notabilis] 99 4e-20 gb|EXB54661.1| L-ascorbate oxidase [Morus notabilis] 99 4e-20 ref|XP_009381228.1| PREDICTED: L-ascorbate oxidase [Musa acumina... 99 4e-20 >ref|XP_011080467.1| L-ascorbate oxidase [Sesamum indicum] Length = 583 Score = 107 bits (268), Expect = 5e-23 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLH 581 NPGVWAFHCHIEPHLHMGMGVVFAEGVRR+ +IPNEAL CGLTGK+LMNN+H Sbjct: 531 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRVKRIPNEALACGLTGKLLMNNVH 582 >gb|KVG89796.1| Cupredoxin [Cynara cardunculus var. scolymus] Length = 584 Score = 105 bits (261), Expect = 4e-22 Identities = 46/53 (86%), Positives = 47/53 (88%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLHMGMGVVFAEGV +GKIPNEAL CGLTGKMLM HN Sbjct: 532 NPGVWAFHCHIEPHLHMGMGVVFAEGVHLVGKIPNEALSCGLTGKMLMGKQHN 584 >ref|XP_021993780.1| L-ascorbate oxidase-like [Helianthus annuus] gb|OTG08259.1| putative L-ascorbate oxidase [Helianthus annuus] Length = 581 Score = 103 bits (256), Expect = 2e-21 Identities = 45/53 (84%), Positives = 47/53 (88%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLHMGMGVVFAEGV +G IPNEAL CGLTGKMLM+ HN Sbjct: 529 NPGVWAFHCHIEPHLHMGMGVVFAEGVHLVGNIPNEALSCGLTGKMLMSKPHN 581 >ref|XP_016456940.1| PREDICTED: L-ascorbate oxidase-like [Nicotiana tabacum] ref|XP_018631763.1| PREDICTED: L-ascorbate oxidase [Nicotiana tomentosiformis] Length = 576 Score = 102 bits (254), Expect = 4e-21 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLHMGMGVVFAEGV + KIP EAL CGLTGKM M+N+HN Sbjct: 524 NPGVWAFHCHIEPHLHMGMGVVFAEGVHLVKKIPKEALACGLTGKMFMSNMHN 576 >ref|XP_009763033.1| PREDICTED: L-ascorbate oxidase isoform X2 [Nicotiana sylvestris] ref|XP_016509366.1| PREDICTED: L-ascorbate oxidase isoform X2 [Nicotiana tabacum] Length = 578 Score = 102 bits (254), Expect = 4e-21 Identities = 45/53 (84%), Positives = 47/53 (88%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLHMGMGVVFAEGV + KIP EAL CGLTGKMLM+N HN Sbjct: 526 NPGVWAFHCHIEPHLHMGMGVVFAEGVHLVKKIPKEALACGLTGKMLMSNKHN 578 >emb|CDN40973.1| Ascorbate oxidase [Nicotiana benthamiana] Length = 578 Score = 102 bits (254), Expect = 4e-21 Identities = 45/53 (84%), Positives = 47/53 (88%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLHMGMGVVFAEGV + KIP EAL CGLTGKMLM+N HN Sbjct: 526 NPGVWAFHCHIEPHLHMGMGVVFAEGVHLVKKIPKEALACGLTGKMLMSNKHN 578 >ref|XP_010251700.1| PREDICTED: L-ascorbate oxidase-like [Nelumbo nucifera] Length = 583 Score = 102 bits (254), Expect = 4e-21 Identities = 43/50 (86%), Positives = 47/50 (94%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNN 587 NPGVWAFHCHIEPHLHMGMGV+FAEGV R+ KIPNEAL CGLTGK++MNN Sbjct: 531 NPGVWAFHCHIEPHLHMGMGVIFAEGVERVRKIPNEALACGLTGKLMMNN 580 >ref|XP_009763032.1| PREDICTED: L-ascorbate oxidase isoform X1 [Nicotiana sylvestris] Length = 578 Score = 102 bits (253), Expect = 5e-21 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLHMGMGV+FAEGV + KIP EAL CGLTGKMLM+N HN Sbjct: 526 NPGVWAFHCHIEPHLHMGMGVIFAEGVHLVKKIPKEALACGLTGKMLMSNKHN 578 >ref|NP_001313101.1| L-ascorbate oxidase precursor [Nicotiana tabacum] sp|Q40588.1|ASO_TOBAC RecName: Full=L-ascorbate oxidase; Short=ASO; Short=Ascorbase; Flags: Precursor dbj|BAA07734.1| ascorbate oxidase precursor [Nicotiana tabacum] Length = 578 Score = 102 bits (253), Expect = 5e-21 Identities = 44/53 (83%), Positives = 47/53 (88%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLHMGMGV+FAEGV + KIP EAL CGLTGKMLM+N HN Sbjct: 526 NPGVWAFHCHIEPHLHMGMGVIFAEGVHLVKKIPKEALACGLTGKMLMSNKHN 578 >ref|XP_010535760.1| PREDICTED: L-ascorbate oxidase-like [Tarenaya hassleriana] Length = 569 Score = 101 bits (252), Expect = 6e-21 Identities = 44/49 (89%), Positives = 45/49 (91%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMN 590 NPGVW FHCHIEPHLHMGMGVVFAEGV RLGK+P EALGCGLTGKM MN Sbjct: 518 NPGVWFFHCHIEPHLHMGMGVVFAEGVNRLGKVPPEALGCGLTGKMFMN 566 >gb|PHU03145.1| L-ascorbate oxidase [Capsicum chinense] Length = 188 Score = 96.3 bits (238), Expect = 7e-21 Identities = 42/53 (79%), Positives = 46/53 (86%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLHMGMGV+FAEGV + KIP EAL CGLTGKMLM + H+ Sbjct: 136 NPGVWAFHCHIEPHLHMGMGVIFAEGVPLVKKIPKEALSCGLTGKMLMASKHD 188 >ref|XP_024018277.1| L-ascorbate oxidase-like, partial [Morus notabilis] Length = 322 Score = 99.0 bits (245), Expect = 9e-21 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLH+GMGV+FAEGV R+GKIPNEAL CGLT KM ++ +N Sbjct: 270 NPGVWAFHCHIEPHLHLGMGVIFAEGVHRVGKIPNEALACGLTAKMFLSGKNN 322 >ref|XP_020878847.1| L-ascorbate oxidase [Arabidopsis lyrata subsp. lyrata] gb|EFH48226.1| ascorbate oxidase [Arabidopsis lyrata subsp. lyrata] Length = 570 Score = 100 bits (249), Expect = 2e-20 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVW FHCHIEPHLHMGMGVVFAEG+ R+GKIP+EALGCGLT + LMN HN Sbjct: 518 NPGVWFFHCHIEPHLHMGMGVVFAEGLNRIGKIPDEALGCGLTKQFLMNRNHN 570 >ref|XP_019235254.1| PREDICTED: L-ascorbate oxidase [Nicotiana attenuata] gb|OIT26207.1| l-ascorbate oxidase [Nicotiana attenuata] Length = 578 Score = 100 bits (249), Expect = 2e-20 Identities = 43/53 (81%), Positives = 46/53 (86%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLHMGMGV+FAEGV + KIP EAL CGLTGKM M+N HN Sbjct: 526 NPGVWAFHCHIEPHLHMGMGVIFAEGVHLVKKIPKEALACGLTGKMFMSNKHN 578 >gb|PLY98506.1| hypothetical protein LSAT_7X77240 [Lactuca sativa] Length = 560 Score = 100 bits (248), Expect = 2e-20 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLHMGMGVVFA GV +GKIP+EAL CGLTGK+L +N HN Sbjct: 508 NPGVWAFHCHIEPHLHMGMGVVFASGVHLVGKIPDEALSCGLTGKLLRSNNHN 560 >ref|XP_023762733.1| L-ascorbate oxidase-like [Lactuca sativa] Length = 584 Score = 100 bits (248), Expect = 2e-20 Identities = 43/53 (81%), Positives = 47/53 (88%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLHMGMGVVFA GV +GKIP+EAL CGLTGK+L +N HN Sbjct: 532 NPGVWAFHCHIEPHLHMGMGVVFASGVHLVGKIPDEALSCGLTGKLLRSNNHN 584 >gb|PHT68489.1| hypothetical protein T459_27976 [Capsicum annuum] Length = 132 Score = 93.2 bits (230), Expect = 3e-20 Identities = 41/53 (77%), Positives = 45/53 (84%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLHMGM V+FAEGV + KIP EAL CGLTGKMLM + H+ Sbjct: 80 NPGVWAFHCHIEPHLHMGMRVIFAEGVPLVKKIPKEALSCGLTGKMLMASKHD 132 >ref|XP_024019721.1| L-ascorbate oxidase [Morus notabilis] Length = 466 Score = 99.0 bits (245), Expect = 4e-20 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLH+GMGV+FAEGV R+GKIPNEAL CGLT KM ++ +N Sbjct: 414 NPGVWAFHCHIEPHLHLGMGVIFAEGVHRVGKIPNEALACGLTAKMFLSGKNN 466 >gb|EXB54661.1| L-ascorbate oxidase [Morus notabilis] Length = 469 Score = 99.0 bits (245), Expect = 4e-20 Identities = 41/53 (77%), Positives = 47/53 (88%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNNLHN 578 NPGVWAFHCHIEPHLH+GMGV+FAEGV R+GKIPNEAL CGLT KM ++ +N Sbjct: 417 NPGVWAFHCHIEPHLHLGMGVIFAEGVHRVGKIPNEALACGLTAKMFLSGKNN 469 >ref|XP_009381228.1| PREDICTED: L-ascorbate oxidase [Musa acuminata subsp. malaccensis] Length = 575 Score = 99.4 bits (246), Expect = 4e-20 Identities = 42/50 (84%), Positives = 46/50 (92%) Frame = -1 Query: 736 NPGVWAFHCHIEPHLHMGMGVVFAEGVRRLGKIPNEALGCGLTGKMLMNN 587 NPGVWAFHCHIEPHLHMGMGV+FAEGV +GKIP EAL CG+TGKMLM+N Sbjct: 523 NPGVWAFHCHIEPHLHMGMGVIFAEGVEHVGKIPKEALVCGMTGKMLMHN 572