BLASTX nr result
ID: Rehmannia29_contig00022443
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00022443 (415 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN26541.1| hypothetical protein CDL12_00711 [Handroanthus im... 55 5e-06 >gb|PIN26541.1| hypothetical protein CDL12_00711 [Handroanthus impetiginosus] Length = 398 Score = 55.1 bits (131), Expect = 5e-06 Identities = 25/32 (78%), Positives = 27/32 (84%) Frame = +3 Query: 318 MKQFNSSVPRNTFSSIFVKFGVCFLFLGLAYR 413 MKQFN +V RNTFSS+ VKF VCFL LGLAYR Sbjct: 1 MKQFNKNVHRNTFSSVLVKFAVCFLLLGLAYR 32