BLASTX nr result
ID: Rehmannia29_contig00022436
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00022436 (542 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011080314.1| putative E3 ubiquitin-protein ligase LIN-1 [... 58 1e-06 >ref|XP_011080314.1| putative E3 ubiquitin-protein ligase LIN-1 [Sesamum indicum] ref|XP_020550036.1| putative E3 ubiquitin-protein ligase LIN-1 [Sesamum indicum] Length = 1120 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/38 (71%), Positives = 31/38 (81%) Frame = +1 Query: 232 RRTGAKSFLDGLQDEEIVNAMDHLLVFLQTCPLEQTPI 345 RR AK FL+GL DE I+NAMD LLV+LQTC LEQTP+ Sbjct: 835 RRNEAKRFLEGLHDEGIINAMDDLLVYLQTCTLEQTPL 872