BLASTX nr result
ID: Rehmannia29_contig00022088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00022088 (1103 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_022867006.1| putative late blight resistance protein homo... 62 1e-06 ref|XP_011089745.1| putative late blight resistance protein homo... 59 8e-06 >ref|XP_022867006.1| putative late blight resistance protein homolog R1A-10 [Olea europaea var. sylvestris] Length = 912 Score = 62.0 bits (149), Expect = 1e-06 Identities = 35/60 (58%), Positives = 46/60 (76%), Gaps = 2/60 (3%) Frame = +1 Query: 919 MAYAAVILLMRNLEEILLPDSY--PIHLKKDQIEYLQKEFSLFLKLFMEDSQESEYDHEV 1092 MAYAAV+LLMR+LEE+L ++ PI LKK+ IE L KE SL L++ ++DSQE YDH+V Sbjct: 1 MAYAAVVLLMRDLEELLHSQAHPIPIGLKKEHIESLHKEVSL-LQVSLKDSQEKMYDHDV 59 >ref|XP_011089745.1| putative late blight resistance protein homolog R1A-10 [Sesamum indicum] Length = 894 Score = 59.3 bits (142), Expect = 8e-06 Identities = 34/61 (55%), Positives = 46/61 (75%), Gaps = 3/61 (4%) Frame = +1 Query: 919 MAYAAVILLMRNLEEILLPDSYPI--HLKKDQIEYLQKEFSLFLKLFM-EDSQESEYDHE 1089 MAYAAV+L M++LE+IL PD + H+ KDQIE L+ E + FLKLF+ EDS E E+DH+ Sbjct: 1 MAYAAVVLFMQSLEQILQPDYSHLLHHVSKDQIESLRDEVN-FLKLFLHEDSDEREHDHQ 59 Query: 1090 V 1092 + Sbjct: 60 L 60