BLASTX nr result
ID: Rehmannia29_contig00022086
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00022086 (1038 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012853203.1| PREDICTED: very-long-chain 3-oxoacyl-CoA red... 76 4e-12 ref|XP_011099188.1| 3-ketodihydrosphingosine reductase [Sesamum ... 74 2e-11 gb|PIN18241.1| 17 beta-hydroxysteroid dehydrogenase type 3, HSD1... 70 7e-10 emb|CDP02478.1| unnamed protein product [Coffea canephora] 67 5e-09 gb|OWM66234.1| hypothetical protein CDL15_Pgr013451 [Punica gran... 65 3e-08 ref|XP_015873523.1| PREDICTED: uncharacterized protein LOC107410... 62 4e-08 gb|PKI36498.1| hypothetical protein CRG98_043107 [Punica granatum] 65 4e-08 ref|XP_009366774.1| PREDICTED: 3-ketodihydrosphingosine reductas... 64 6e-08 gb|POO02760.1| Short-chain dehydrogenase/reductase [Trema orient... 64 6e-08 ref|XP_009366835.1| PREDICTED: uncharacterized protein LOC103956... 64 6e-08 ref|XP_008338290.1| PREDICTED: 3-ketodihydrosphingosine reductas... 64 7e-08 ref|XP_019194979.1| PREDICTED: carbonyl reductase family member ... 64 9e-08 ref|XP_023517544.1| uncharacterized protein LOC111781272 [Cucurb... 64 9e-08 ref|XP_023003956.1| uncharacterized protein LOC111497403 [Cucurb... 64 9e-08 ref|XP_022962741.1| uncharacterized protein LOC111463140 [Cucurb... 64 9e-08 ref|XP_008440254.1| PREDICTED: 3-ketodihydrosphingosine reductas... 64 9e-08 ref|XP_004141923.1| PREDICTED: 3-ketodihydrosphingosine reductas... 64 9e-08 ref|XP_007204511.2| 3-ketodihydrosphingosine reductase [Prunus p... 63 2e-07 ref|XP_008241520.1| PREDICTED: very-long-chain 3-oxoacyl-CoA red... 63 2e-07 ref|XP_009611546.1| PREDICTED: 3-ketodihydrosphingosine reductas... 63 2e-07 >ref|XP_012853203.1| PREDICTED: very-long-chain 3-oxoacyl-CoA reductase [Erythranthe guttata] gb|EYU44375.1| hypothetical protein MIMGU_mgv1a011828mg [Erythranthe guttata] Length = 269 Score = 76.3 bits (186), Expect = 4e-12 Identities = 34/35 (97%), Positives = 34/35 (97%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSRLV 177 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGG RLV Sbjct: 235 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGPRLV 269 >ref|XP_011099188.1| 3-ketodihydrosphingosine reductase [Sesamum indicum] Length = 265 Score = 73.9 bits (180), Expect = 2e-11 Identities = 32/35 (91%), Positives = 34/35 (97%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSRLV 177 MDPDVLAQTYWQLHVQDRSTWTQE+DLRPGG RL+ Sbjct: 231 MDPDVLAQTYWQLHVQDRSTWTQEMDLRPGGPRLL 265 >gb|PIN18241.1| 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Handroanthus impetiginosus] Length = 264 Score = 69.7 bits (169), Expect = 7e-10 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = +1 Query: 70 AMDPDVLAQTYWQLHVQDRSTWTQEIDLRPG 162 +MDPDVLAQTYWQLHVQDRSTWTQEIDLRPG Sbjct: 230 SMDPDVLAQTYWQLHVQDRSTWTQEIDLRPG 260 >emb|CDP02478.1| unnamed protein product [Coffea canephora] Length = 270 Score = 67.4 bits (163), Expect = 5e-09 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSRL 174 MDPDVLAQTYWQLH+QDRS WTQEIDLRP S L Sbjct: 236 MDPDVLAQTYWQLHIQDRSAWTQEIDLRPSNSSL 269 >gb|OWM66234.1| hypothetical protein CDL15_Pgr013451 [Punica granatum] Length = 263 Score = 64.7 bits (156), Expect = 3e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSRL 174 MDPD LAQTYW LH+QDR+ WTQEIDLRP G RL Sbjct: 229 MDPDSLAQTYWHLHIQDRTAWTQEIDLRPSGPRL 262 >ref|XP_015873523.1| PREDICTED: uncharacterized protein LOC107410589 [Ziziphus jujuba] Length = 118 Score = 61.6 bits (148), Expect = 4e-08 Identities = 26/34 (76%), Positives = 28/34 (82%) Frame = +1 Query: 70 AMDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSR 171 +MDPD LAQTYW LHVQDR+ WTQEIDLRP R Sbjct: 83 SMDPDALAQTYWHLHVQDRTAWTQEIDLRPSTPR 116 >gb|PKI36498.1| hypothetical protein CRG98_043107 [Punica granatum] Length = 266 Score = 64.7 bits (156), Expect = 4e-08 Identities = 27/34 (79%), Positives = 29/34 (85%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSRL 174 MDPD LAQTYW LH+QDR+ WTQEIDLRP G RL Sbjct: 232 MDPDSLAQTYWHLHIQDRTAWTQEIDLRPSGPRL 265 >ref|XP_009366774.1| PREDICTED: 3-ketodihydrosphingosine reductase-like isoform X1 [Pyrus x bretschneideri] ref|XP_009375683.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Pyrus x bretschneideri] Length = 256 Score = 63.9 bits (154), Expect = 6e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRP 159 MDPDV+AQTYWQLHVQDRS WTQEIDLRP Sbjct: 221 MDPDVVAQTYWQLHVQDRSAWTQEIDLRP 249 >gb|POO02760.1| Short-chain dehydrogenase/reductase [Trema orientalis] Length = 261 Score = 63.9 bits (154), Expect = 6e-08 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +1 Query: 70 AMDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSR 171 +MDPD +AQTYW LHVQDR+TWTQEIDLRP +R Sbjct: 226 SMDPDAVAQTYWHLHVQDRTTWTQEIDLRPSSTR 259 >ref|XP_009366835.1| PREDICTED: uncharacterized protein LOC103956551 [Pyrus x bretschneideri] Length = 262 Score = 63.9 bits (154), Expect = 6e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRP 159 MDPDV+AQTYWQLHVQDRS WTQEIDLRP Sbjct: 227 MDPDVVAQTYWQLHVQDRSAWTQEIDLRP 255 >ref|XP_008338290.1| PREDICTED: 3-ketodihydrosphingosine reductase [Malus domestica] ref|XP_008367974.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Malus domestica] Length = 273 Score = 63.9 bits (154), Expect = 7e-08 Identities = 27/29 (93%), Positives = 28/29 (96%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRP 159 MDPDV+AQTYWQLHVQDRS WTQEIDLRP Sbjct: 224 MDPDVVAQTYWQLHVQDRSAWTQEIDLRP 252 >ref|XP_019194979.1| PREDICTED: carbonyl reductase family member 4 [Ipomoea nil] ref|XP_019194980.1| PREDICTED: carbonyl reductase family member 4 [Ipomoea nil] Length = 264 Score = 63.5 bits (153), Expect = 9e-08 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSRLV 177 MDP+ LAQTYWQLH+QDRS WTQE+DLRP SR++ Sbjct: 230 MDPEALAQTYWQLHIQDRSAWTQEMDLRPCNSRVL 264 >ref|XP_023517544.1| uncharacterized protein LOC111781272 [Cucurbita pepo subsp. pepo] Length = 270 Score = 63.5 bits (153), Expect = 9e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSRL 174 MDPD LAQTYW LHVQDR+ WTQEIDLRP RL Sbjct: 236 MDPDALAQTYWHLHVQDRTAWTQEIDLRPSNPRL 269 >ref|XP_023003956.1| uncharacterized protein LOC111497403 [Cucurbita maxima] Length = 270 Score = 63.5 bits (153), Expect = 9e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSRL 174 MDPD LAQTYW LHVQDR+ WTQEIDLRP RL Sbjct: 236 MDPDALAQTYWHLHVQDRTAWTQEIDLRPSNPRL 269 >ref|XP_022962741.1| uncharacterized protein LOC111463140 [Cucurbita moschata] Length = 270 Score = 63.5 bits (153), Expect = 9e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSRL 174 MDPD LAQTYW LHVQDR+ WTQEIDLRP RL Sbjct: 236 MDPDALAQTYWHLHVQDRTAWTQEIDLRPSNPRL 269 >ref|XP_008440254.1| PREDICTED: 3-ketodihydrosphingosine reductase [Cucumis melo] Length = 272 Score = 63.5 bits (153), Expect = 9e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSRL 174 MDPD LAQTYW LHVQDR+ WTQEIDLRP RL Sbjct: 238 MDPDALAQTYWHLHVQDRTAWTQEIDLRPSNPRL 271 >ref|XP_004141923.1| PREDICTED: 3-ketodihydrosphingosine reductase [Cucumis sativus] gb|KGN48510.1| hypothetical protein Csa_6G490250 [Cucumis sativus] Length = 272 Score = 63.5 bits (153), Expect = 9e-08 Identities = 27/34 (79%), Positives = 28/34 (82%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSRL 174 MDPD LAQTYW LHVQDR+ WTQEIDLRP RL Sbjct: 238 MDPDALAQTYWHLHVQDRTAWTQEIDLRPSNPRL 271 >ref|XP_007204511.2| 3-ketodihydrosphingosine reductase [Prunus persica] gb|ONH96550.1| hypothetical protein PRUPE_7G136500 [Prunus persica] gb|ONH96551.1| hypothetical protein PRUPE_7G136500 [Prunus persica] Length = 259 Score = 62.8 bits (151), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 70 AMDPDVLAQTYWQLHVQDRSTWTQEIDLRP 159 +MDPD +AQTYWQLHVQDRS WTQEIDLRP Sbjct: 223 SMDPDAVAQTYWQLHVQDRSAWTQEIDLRP 252 >ref|XP_008241520.1| PREDICTED: very-long-chain 3-oxoacyl-CoA reductase [Prunus mume] Length = 259 Score = 62.8 bits (151), Expect = 2e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +1 Query: 70 AMDPDVLAQTYWQLHVQDRSTWTQEIDLRP 159 +MDPD +AQTYWQLHVQDRS WTQEIDLRP Sbjct: 223 SMDPDAVAQTYWQLHVQDRSAWTQEIDLRP 252 >ref|XP_009611546.1| PREDICTED: 3-ketodihydrosphingosine reductase-like [Nicotiana tomentosiformis] Length = 264 Score = 62.8 bits (151), Expect = 2e-07 Identities = 26/33 (78%), Positives = 27/33 (81%) Frame = +1 Query: 73 MDPDVLAQTYWQLHVQDRSTWTQEIDLRPGGSR 171 MDPD LAQTYW LH+QDRSTWTQEIDL P R Sbjct: 230 MDPDALAQTYWHLHIQDRSTWTQEIDLHPSNPR 262