BLASTX nr result
ID: Rehmannia29_contig00021898
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00021898 (404 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012836538.1| PREDICTED: uncharacterized protein LOC105957... 50 9e-06 >ref|XP_012836538.1| PREDICTED: uncharacterized protein LOC105957157 [Erythranthe guttata] gb|EYU45911.1| hypothetical protein MIMGU_mgv1a015271mg [Erythranthe guttata] Length = 163 Score = 50.4 bits (119), Expect(2) = 9e-06 Identities = 22/32 (68%), Positives = 26/32 (81%) Frame = +3 Query: 3 YLDETKELEISTQRILASFRQRNRNGSGGRCE 98 YLDETKE+EISTQ++L SFR+R GGRCE Sbjct: 106 YLDETKEMEISTQKMLESFRRRRNRDGGGRCE 137 Score = 26.6 bits (57), Expect(2) = 9e-06 Identities = 13/20 (65%), Positives = 16/20 (80%), Gaps = 1/20 (5%) Frame = +2 Query: 116 EFRERRRPF-SSPKNRVIFL 172 ++R RR PF SS K+RVIFL Sbjct: 144 DYRRRRHPFSSSQKSRVIFL 163