BLASTX nr result
ID: Rehmannia29_contig00021893
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00021893 (431 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_020554806.1| pentatricopeptide repeat-containing protein ... 221 3e-65 gb|PIN03444.1| hypothetical protein CDL12_24042 [Handroanthus im... 207 1e-62 gb|PIN07017.1| hypothetical protein CDL12_20410 [Handroanthus im... 208 9e-61 gb|EYU44833.1| hypothetical protein MIMGU_mgv1a017808mg, partial... 192 4e-55 ref|XP_012850198.1| PREDICTED: pentatricopeptide repeat-containi... 192 8e-55 ref|XP_022879297.1| pentatricopeptide repeat-containing protein ... 191 5e-54 ref|XP_017975872.1| PREDICTED: pentatricopeptide repeat-containi... 188 3e-53 ref|XP_021299295.1| LOW QUALITY PROTEIN: pentatricopeptide repea... 187 7e-53 ref|XP_022740173.1| pentatricopeptide repeat-containing protein ... 186 1e-52 gb|EOY02618.1| Pentatricopeptide repeat (PPR-like) superfamily p... 186 3e-52 ref|XP_002324000.1| pentatricopeptide repeat-containing family p... 184 7e-52 gb|OMO95005.1| hypothetical protein CCACVL1_05649 [Corchorus cap... 184 9e-52 gb|PNS95652.1| hypothetical protein POPTR_017G070800v3 [Populus ... 184 1e-51 dbj|GAY65229.1| hypothetical protein CUMW_239580 [Citrus unshiu] 183 2e-51 ref|XP_006447217.1| pentatricopeptide repeat-containing protein ... 183 2e-51 ref|XP_006338641.1| PREDICTED: pentatricopeptide repeat-containi... 182 3e-51 gb|KZV15158.1| pentatricopeptide repeat-containing protein-like ... 182 8e-51 ref|XP_011010493.1| PREDICTED: pentatricopeptide repeat-containi... 182 8e-51 gb|PHT57373.1| Pentatricopeptide repeat-containing protein [Caps... 181 9e-51 ref|XP_021677748.1| pentatricopeptide repeat-containing protein ... 181 2e-50 >ref|XP_020554806.1| pentatricopeptide repeat-containing protein At3g46610 [Sesamum indicum] Length = 778 Score = 221 bits (563), Expect = 3e-65 Identities = 104/120 (86%), Positives = 114/120 (95%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWFQRMKL+NITPNEVTYEMLIEAL KDGKPR+AYELHLRAHNEGLVLS KAYDAV++SS Sbjct: 659 EWFQRMKLQNITPNEVTYEMLIEALTKDGKPRLAYELHLRAHNEGLVLSTKAYDAVIQSS 718 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSEELHR 360 QTYGATID+S+LGPRPPERKK V+IR+NLSEFCNLAGVPRRSKPF++ EIYT Q EELHR Sbjct: 719 QTYGATIDISSLGPRPPERKKNVQIRKNLSEFCNLAGVPRRSKPFDRSEIYTPQKEELHR 778 >gb|PIN03444.1| hypothetical protein CDL12_24042 [Handroanthus impetiginosus] Length = 456 Score = 207 bits (527), Expect = 1e-62 Identities = 100/117 (85%), Positives = 109/117 (93%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWFQRMKL N+TPNEVTYE LIEALA DGKPR+AYELHLRA NEGL+LS+KAYDAVV+SS Sbjct: 340 EWFQRMKLHNVTPNEVTYETLIEALANDGKPRLAYELHLRAQNEGLMLSSKAYDAVVQSS 399 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSEE 351 Q YGATIDVSTLGP+PPERKKKVEIR+NLSEFCNLA VPRRSKPF+K EIY SQ+EE Sbjct: 400 QMYGATIDVSTLGPQPPERKKKVEIRKNLSEFCNLADVPRRSKPFDKSEIYNSQNEE 456 >gb|PIN07017.1| hypothetical protein CDL12_20410 [Handroanthus impetiginosus] Length = 739 Score = 208 bits (530), Expect = 9e-61 Identities = 101/117 (86%), Positives = 109/117 (93%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWFQRMKL N+TPNEVTYE LIEALA DGKPR+AYELHLRA NEGL+LS+KAYDAVV+SS Sbjct: 623 EWFQRMKLHNVTPNEVTYETLIEALANDGKPRLAYELHLRAQNEGLMLSSKAYDAVVQSS 682 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSEE 351 Q YGATIDVSTLGPRPPE KKKVEIR+NLSEFCNLA VPRRSKPF+KREIY SQ+EE Sbjct: 683 QMYGATIDVSTLGPRPPEGKKKVEIRKNLSEFCNLADVPRRSKPFDKREIYNSQNEE 739 >gb|EYU44833.1| hypothetical protein MIMGU_mgv1a017808mg, partial [Erythranthe guttata] Length = 659 Score = 192 bits (488), Expect = 4e-55 Identities = 93/117 (79%), Positives = 107/117 (91%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 E+FQRM++ NI PNEVTY++LIEALA DGKPR+AYELHLRA+NEGLVLS KAYDAVVESS Sbjct: 540 EYFQRMRVLNIAPNEVTYDVLIEALASDGKPRLAYELHLRANNEGLVLSTKAYDAVVESS 599 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSEE 351 ++YGATIDVS LGPRPPERKKKV+ R+ LSEFC+LA VPRRSKPF++ EIY SQSEE Sbjct: 600 ESYGATIDVSALGPRPPERKKKVQTRKKLSEFCDLADVPRRSKPFDRSEIYKSQSEE 656 >ref|XP_012850198.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46610 [Erythranthe guttata] Length = 723 Score = 192 bits (488), Expect = 8e-55 Identities = 93/117 (79%), Positives = 107/117 (91%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 E+FQRM++ NI PNEVTY++LIEALA DGKPR+AYELHLRA+NEGLVLS KAYDAVVESS Sbjct: 604 EYFQRMRVLNIAPNEVTYDVLIEALASDGKPRLAYELHLRANNEGLVLSTKAYDAVVESS 663 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSEE 351 ++YGATIDVS LGPRPPERKKKV+ R+ LSEFC+LA VPRRSKPF++ EIY SQSEE Sbjct: 664 ESYGATIDVSALGPRPPERKKKVQTRKKLSEFCDLADVPRRSKPFDRSEIYKSQSEE 720 >ref|XP_022879297.1| pentatricopeptide repeat-containing protein At3g46610-like [Olea europaea var. sylvestris] Length = 826 Score = 191 bits (485), Expect = 5e-54 Identities = 89/117 (76%), Positives = 108/117 (92%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWFQRMKL NITPNEVTYEMLIEALA DGKPR+AYEL+LRA NEGL LS+KAYD VV+SS Sbjct: 705 EWFQRMKLRNITPNEVTYEMLIEALANDGKPRLAYELYLRAQNEGLALSSKAYDTVVQSS 764 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSEE 351 + YGATIDVSTLGPRPP++K KV+I +NLS+FC++A VPRRSKPF+++EIY++Q+E+ Sbjct: 765 EVYGATIDVSTLGPRPPDKKGKVQIGKNLSKFCSIADVPRRSKPFDRQEIYSAQTED 821 >ref|XP_017975872.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46610 [Theobroma cacao] Length = 741 Score = 188 bits (477), Expect = 3e-53 Identities = 86/111 (77%), Positives = 104/111 (93%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWF RMK++NI+PNE+TY+MLIEALAKDGKPR+AYEL+LRAHNEGL LS+KAYDAVV+SS Sbjct: 623 EWFHRMKVQNISPNEITYQMLIEALAKDGKPRLAYELYLRAHNEGLNLSSKAYDAVVQSS 682 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIY 333 Q YGAT D+S LGPRPP++KKKV+IR+ L+EFCNLA VPRRSKPF+++EIY Sbjct: 683 QVYGATTDLSVLGPRPPDKKKKVQIRKTLTEFCNLADVPRRSKPFDRKEIY 733 >ref|XP_021299295.1| LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g46610-like [Herrania umbratica] Length = 740 Score = 187 bits (475), Expect = 7e-53 Identities = 85/114 (74%), Positives = 106/114 (92%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWF RMK++NI+PNE+TY+MLIEALAKDGKPR+AYEL+LRAHNEGL LS+KAYDAVV+SS Sbjct: 622 EWFHRMKVQNISPNEITYQMLIEALAKDGKPRLAYELYLRAHNEGLNLSSKAYDAVVQSS 681 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQ 342 Q YGAT D+S LGPRPP++K+KV+IR+ L+EFCNLA VPRRSKPF+++EIY ++ Sbjct: 682 QVYGATTDLSVLGPRPPDKKRKVQIRKTLTEFCNLADVPRRSKPFDRKEIYIAK 735 >ref|XP_022740173.1| pentatricopeptide repeat-containing protein At3g46610 [Durio zibethinus] Length = 740 Score = 186 bits (473), Expect = 1e-52 Identities = 86/111 (77%), Positives = 102/111 (91%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWF RMK++NI+PNE+TYEMLI+ALAKDGKPR+AYEL+LRAHNEGL LS+KAYDAVV+S Sbjct: 622 EWFHRMKVQNISPNEITYEMLIDALAKDGKPRLAYELYLRAHNEGLNLSSKAYDAVVQSC 681 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIY 333 Q YGAT D+S LGPRPP+RKKKV+IR+ L+EFCNLA VPRRSKPF ++EIY Sbjct: 682 QVYGATTDLSVLGPRPPDRKKKVQIRKTLTEFCNLADVPRRSKPFNRKEIY 732 >gb|EOY02618.1| Pentatricopeptide repeat (PPR-like) superfamily protein, putative [Theobroma cacao] Length = 741 Score = 186 bits (471), Expect = 3e-52 Identities = 85/111 (76%), Positives = 103/111 (92%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWF RMK++NI+PNE+TY+MLIEALAKDGKPR+AYEL+LRAHNEGL LS+KAYDAVV+SS Sbjct: 623 EWFHRMKVQNISPNEITYQMLIEALAKDGKPRLAYELYLRAHNEGLNLSSKAYDAVVQSS 682 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIY 333 Q YGAT D+S LGPRPP++K KV+IR+ L+EFCNLA VPRRSKPF+++EIY Sbjct: 683 QVYGATTDLSVLGPRPPDKKMKVQIRKTLTEFCNLADVPRRSKPFDRKEIY 733 >ref|XP_002324000.1| pentatricopeptide repeat-containing family protein [Populus trichocarpa] gb|PNS95651.1| hypothetical protein POPTR_017G070800v3 [Populus trichocarpa] Length = 709 Score = 184 bits (467), Expect = 7e-52 Identities = 86/116 (74%), Positives = 102/116 (87%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWF RMK++NI+PNE+TY+MLIEALAK GKPR+AYEL+LRA NE L LS KAYDAV+ SS Sbjct: 593 EWFHRMKVQNISPNEITYDMLIEALAKSGKPRLAYELYLRAQNEDLQLSPKAYDAVMHSS 652 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSE 348 + YGATID S LGPRPP++KKKV+IR+ L+EFCNLA VPRRSKPF K+EIY SQ+E Sbjct: 653 EAYGATIDTSVLGPRPPDKKKKVQIRKTLTEFCNLADVPRRSKPFNKKEIYASQAE 708 >gb|OMO95005.1| hypothetical protein CCACVL1_05649 [Corchorus capsularis] Length = 740 Score = 184 bits (467), Expect = 9e-52 Identities = 85/114 (74%), Positives = 103/114 (90%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWF RMK++NI+PNE+TYEMLIEALAKDGKPR+AYEL+LRA NEGL LS+KAYDAVV+SS Sbjct: 622 EWFHRMKVQNISPNEITYEMLIEALAKDGKPRLAYELYLRARNEGLKLSSKAYDAVVQSS 681 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQ 342 Q YGAT D+S LGPRPP++KK V+IR+ L+EFCNLA VPRRSKPF+++EI+ Q Sbjct: 682 QAYGATTDLSVLGPRPPDKKKNVQIRKTLTEFCNLADVPRRSKPFDRKEIFIPQ 735 >gb|PNS95652.1| hypothetical protein POPTR_017G070800v3 [Populus trichocarpa] Length = 759 Score = 184 bits (467), Expect = 1e-51 Identities = 86/116 (74%), Positives = 102/116 (87%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWF RMK++NI+PNE+TY+MLIEALAK GKPR+AYEL+LRA NE L LS KAYDAV+ SS Sbjct: 643 EWFHRMKVQNISPNEITYDMLIEALAKSGKPRLAYELYLRAQNEDLQLSPKAYDAVMHSS 702 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSE 348 + YGATID S LGPRPP++KKKV+IR+ L+EFCNLA VPRRSKPF K+EIY SQ+E Sbjct: 703 EAYGATIDTSVLGPRPPDKKKKVQIRKTLTEFCNLADVPRRSKPFNKKEIYASQAE 758 >dbj|GAY65229.1| hypothetical protein CUMW_239580 [Citrus unshiu] Length = 768 Score = 183 bits (465), Expect = 2e-51 Identities = 85/116 (73%), Positives = 104/116 (89%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWF RMK++NI+PNE+TYEMLIEALAKDGKPR+AY+L+LRA NE L LS+KAYDA++E S Sbjct: 649 EWFHRMKVQNISPNEITYEMLIEALAKDGKPRLAYDLYLRARNEELNLSSKAYDAILEFS 708 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSE 348 Q YGATID++ LGPRPP++KKKV IR+NLS FC+ A VPRRSKPF+K+EIYT Q+E Sbjct: 709 QVYGATIDLTVLGPRPPDKKKKVVIRKNLSNFCHFADVPRRSKPFDKKEIYTPQTE 764 >ref|XP_006447217.1| pentatricopeptide repeat-containing protein At3g46610 [Citrus clementina] ref|XP_006469938.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46610 [Citrus sinensis] gb|ESR60457.1| hypothetical protein CICLE_v10014357mg [Citrus clementina] Length = 768 Score = 183 bits (465), Expect = 2e-51 Identities = 85/116 (73%), Positives = 104/116 (89%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWF RMK++NI+PNE+TYEMLIEALAKDGKPR+AY+L+LRA NE L LS+KAYDA++E S Sbjct: 649 EWFHRMKVQNISPNEITYEMLIEALAKDGKPRLAYDLYLRARNEELNLSSKAYDAILEFS 708 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSE 348 Q YGATID++ LGPRPP++KKKV IR+NLS FC+ A VPRRSKPF+K+EIYT Q+E Sbjct: 709 QVYGATIDLTVLGPRPPDKKKKVVIRKNLSNFCHFADVPRRSKPFDKKEIYTPQTE 764 >ref|XP_006338641.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46610-like [Solanum tuberosum] Length = 740 Score = 182 bits (463), Expect = 3e-51 Identities = 84/117 (71%), Positives = 105/117 (89%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWFQRMK +NITPNEV+YEMLIEALA DGKPR+AYEL++RA EGL LS KAYDAV+ S+ Sbjct: 623 EWFQRMKTQNITPNEVSYEMLIEALANDGKPRLAYELYVRALTEGLSLSTKAYDAVISST 682 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSEE 351 Q YGA+ID+S LGPRPPE+KK+V+IR++LSEFCN+A VPRRS+PF++ EI+T+Q+ E Sbjct: 683 QAYGASIDLSILGPRPPEKKKRVQIRKSLSEFCNIADVPRRSRPFDREEIFTAQTNE 739 >gb|KZV15158.1| pentatricopeptide repeat-containing protein-like [Dorcoceras hygrometricum] Length = 758 Score = 182 bits (461), Expect = 8e-51 Identities = 81/117 (69%), Positives = 104/117 (88%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWF+RM+++ ITPNE+TYE+LIEALA DGKPR+AYE+HLRA EGLVLS KAYD+V+ S+ Sbjct: 642 EWFKRMEVQKITPNEITYEILIEALANDGKPRLAYEMHLRAQKEGLVLSTKAYDSVIRSA 701 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSEE 351 + YGATID+S LG RPPE+KK+V+IR++LSEFCN A VPRRSKPF ++E+Y +Q+EE Sbjct: 702 RMYGATIDISNLGARPPEKKKRVQIRKDLSEFCNFADVPRRSKPFNRKEVYVTQTEE 758 >ref|XP_011010493.1| PREDICTED: pentatricopeptide repeat-containing protein At3g46610 [Populus euphratica] Length = 761 Score = 182 bits (461), Expect = 8e-51 Identities = 85/116 (73%), Positives = 101/116 (87%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWF RMK++NI+PNE+TY+MLIEALAK GKPR+AYEL+LRA NE L LS KAYDAV+ SS Sbjct: 643 EWFHRMKVQNISPNEITYDMLIEALAKSGKPRLAYELYLRAQNEDLQLSPKAYDAVMHSS 702 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSE 348 + YGATID S LGPRPP++KKKV+IR+ L+EFC LA VPRRSKPF K+EIY SQ+E Sbjct: 703 EAYGATIDTSVLGPRPPDKKKKVQIRKTLTEFCTLADVPRRSKPFNKKEIYASQAE 758 >gb|PHT57373.1| Pentatricopeptide repeat-containing protein [Capsicum baccatum] Length = 737 Score = 181 bits (460), Expect = 9e-51 Identities = 83/116 (71%), Positives = 106/116 (91%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWFQRMK +NITPNEV+YEMLIEALA DGKPR+AYEL++RA +EGL LS KAYDAV+ S+ Sbjct: 620 EWFQRMKTQNITPNEVSYEMLIEALANDGKPRLAYELYVRAISEGLSLSTKAYDAVISSA 679 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSE 348 Q YGATID+S LGPRPPE+KK+V+IR++LSEFCN+A VPRRS+PF++ EI+T++++ Sbjct: 680 QAYGATIDLSILGPRPPEKKKRVQIRKSLSEFCNIADVPRRSRPFDREEIFTARTK 735 >ref|XP_021677748.1| pentatricopeptide repeat-containing protein At3g46610 [Hevea brasiliensis] Length = 765 Score = 181 bits (459), Expect = 2e-50 Identities = 84/116 (72%), Positives = 102/116 (87%) Frame = +1 Query: 1 EWFQRMKLENITPNEVTYEMLIEALAKDGKPRVAYELHLRAHNEGLVLSAKAYDAVVESS 180 EWF RMK++NI PN++TYEMLIEALAKDGKPR+AYELHLRA NEGL LSAK YDAVV SS Sbjct: 647 EWFHRMKVQNIQPNKITYEMLIEALAKDGKPRIAYELHLRAQNEGLNLSAKVYDAVVHSS 706 Query: 181 QTYGATIDVSTLGPRPPERKKKVEIRRNLSEFCNLAGVPRRSKPFEKREIYTSQSE 348 + +GATID+ +LGPRP ++KK+V+IR+ L EFCNLA VPRRSKPF+++EIY +Q E Sbjct: 707 KVHGATIDIHSLGPRPADKKKRVQIRKTLMEFCNLADVPRRSKPFDQKEIYPAQVE 762