BLASTX nr result
ID: Rehmannia29_contig00021825
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00021825 (451 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006358645.1| PREDICTED: ubiquitin-conjugating enzyme E2 2... 53 5e-13 ref|XP_002532936.1| PREDICTED: ubiquitin-conjugating enzyme E2-1... 54 9e-13 ref|XP_022866080.1| ubiquitin-conjugating enzyme E2 10-like [Ole... 53 1e-12 ref|XP_022898037.1| ubiquitin-conjugating enzyme E2 28-like isof... 53 1e-12 ref|XP_022896455.1| ubiquitin-conjugating enzyme E2 28-like [Ole... 53 1e-12 ref|XP_011101854.1| ubiquitin-conjugating enzyme E2 28-like [Ses... 53 1e-12 ref|XP_011093056.1| ubiquitin-conjugating enzyme E2 28-like [Ses... 53 1e-12 ref|XP_011093397.1| ubiquitin-conjugating enzyme E2 28 [Sesamum ... 53 1e-12 gb|KZV49070.1| hypothetical protein F511_11021 [Dorcoceras hygro... 53 1e-12 gb|EPS68461.1| ubiquitin carrier protein, partial [Genlisea aurea] 53 1e-12 gb|KQL10783.1| hypothetical protein SETIT_007428mg [Setaria ital... 53 1e-12 gb|PHT77457.1| Ubiquitin-conjugating enzyme E2-17 kDa [Capsicum ... 53 1e-12 gb|OEL37561.1| Ubiquitin-conjugating enzyme E2 28 [Dichanthelium... 53 1e-12 ref|XP_016581501.1| PREDICTED: ubiquitin-conjugating enzyme E2 2... 53 1e-12 ref|XP_010092395.1| ubiquitin-conjugating enzyme E2-17 kDa [Moru... 53 1e-12 ref|XP_009620231.1| PREDICTED: ubiquitin-conjugating enzyme E2 2... 53 1e-12 ref|XP_012833973.1| PREDICTED: ubiquitin-conjugating enzyme E2 2... 53 1e-12 ref|XP_004965488.1| ubiquitin-conjugating enzyme E2 5B [Setaria ... 53 1e-12 ref|XP_002438462.1| ubiquitin-conjugating enzyme E2 28 [Sorghum ... 53 1e-12 gb|KQL10781.1| hypothetical protein SETIT_007428mg [Setaria ital... 53 2e-12 >ref|XP_006358645.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Solanum tuberosum] Length = 148 Score = 53.1 bits (126), Expect(2) = 5e-13 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 48.5 bits (114), Expect(2) = 5e-13 Identities = 21/26 (80%), Positives = 22/26 (84%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D VK+E AARSWTQKYAMG Sbjct: 123 IAHMYKTDRVKYESAARSWTQKYAMG 148 >ref|XP_002532936.1| PREDICTED: ubiquitin-conjugating enzyme E2-17 kDa [Ricinus communis] gb|EEF29440.1| ubiquitin-conjugating enzyme E2, putative [Ricinus communis] Length = 148 Score = 53.5 bits (127), Expect(2) = 9e-13 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKMD 130 Score = 47.4 bits (111), Expect(2) = 9e-13 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYKMD K+E ARSWTQKYAMG Sbjct: 123 IAHMYKMDRAKYETTARSWTQKYAMG 148 >ref|XP_022866080.1| ubiquitin-conjugating enzyme E2 10-like [Olea europaea var. sylvestris] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.4 bits (111), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D K+EQ ARSWTQKYAMG Sbjct: 123 IAHMYKTDKAKYEQTARSWTQKYAMG 148 >ref|XP_022898037.1| ubiquitin-conjugating enzyme E2 28-like isoform X1 [Olea europaea var. sylvestris] ref|XP_022898038.1| ubiquitin-conjugating enzyme E2 28-like isoform X1 [Olea europaea var. sylvestris] ref|XP_022898039.1| ubiquitin-conjugating enzyme E2 28-like isoform X2 [Olea europaea var. sylvestris] ref|XP_022898040.1| ubiquitin-conjugating enzyme E2 28-like isoform X3 [Olea europaea var. sylvestris] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.4 bits (111), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D K+EQ ARSWTQKYAMG Sbjct: 123 IAHMYKTDKAKYEQTARSWTQKYAMG 148 >ref|XP_022896455.1| ubiquitin-conjugating enzyme E2 28-like [Olea europaea var. sylvestris] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.4 bits (111), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D K+EQ ARSWTQKYAMG Sbjct: 123 IAHMYKTDKAKYEQTARSWTQKYAMG 148 >ref|XP_011101854.1| ubiquitin-conjugating enzyme E2 28-like [Sesamum indicum] ref|XP_011101855.1| ubiquitin-conjugating enzyme E2 28-like [Sesamum indicum] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.4 bits (111), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D K+EQ ARSWTQKYAMG Sbjct: 123 IAHMYKTDRAKYEQTARSWTQKYAMG 148 >ref|XP_011093056.1| ubiquitin-conjugating enzyme E2 28-like [Sesamum indicum] ref|XP_020553497.1| ubiquitin-conjugating enzyme E2 28-like [Sesamum indicum] ref|XP_020553498.1| ubiquitin-conjugating enzyme E2 28-like [Sesamum indicum] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.4 bits (111), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D K+EQ ARSWTQKYAMG Sbjct: 123 IAHMYKTDRTKYEQTARSWTQKYAMG 148 >ref|XP_011093397.1| ubiquitin-conjugating enzyme E2 28 [Sesamum indicum] gb|KZV38025.1| hypothetical protein F511_25251 [Dorcoceras hygrometricum] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.4 bits (111), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D K+EQ ARSWTQKYAMG Sbjct: 123 IAHMYKTDRAKYEQTARSWTQKYAMG 148 >gb|KZV49070.1| hypothetical protein F511_11021 [Dorcoceras hygrometricum] Length = 111 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 54 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 93 Score = 47.4 bits (111), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D K+EQ ARSWTQKYAMG Sbjct: 86 IAHMYKTDRAKYEQTARSWTQKYAMG 111 >gb|EPS68461.1| ubiquitin carrier protein, partial [Genlisea aurea] Length = 82 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 25 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 64 Score = 47.4 bits (111), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D K+EQ ARSWTQKYAMG Sbjct: 57 IAHMYKTDSAKYEQTARSWTQKYAMG 82 >gb|KQL10783.1| hypothetical protein SETIT_007428mg [Setaria italica] Length = 151 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 94 EQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 133 Score = 47.0 bits (110), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D VK+E ARSWTQKYAMG Sbjct: 126 IAHMYKTDRVKYESTARSWTQKYAMG 151 >gb|PHT77457.1| Ubiquitin-conjugating enzyme E2-17 kDa [Capsicum annuum] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.0 bits (110), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D VK+E ARSWTQKYAMG Sbjct: 123 IAHMYKTDRVKYESTARSWTQKYAMG 148 >gb|OEL37561.1| Ubiquitin-conjugating enzyme E2 28 [Dichanthelium oligosanthes] gb|PAN24043.1| hypothetical protein PAHAL_D01501 [Panicum hallii] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.0 bits (110), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D VK+E ARSWTQKYAMG Sbjct: 123 IAHMYKTDRVKYESTARSWTQKYAMG 148 >ref|XP_016581501.1| PREDICTED: ubiquitin-conjugating enzyme E2 28 [Capsicum annuum] ref|XP_016581502.1| PREDICTED: ubiquitin-conjugating enzyme E2 28 [Capsicum annuum] gb|PHT44064.1| hypothetical protein CQW23_18089 [Capsicum baccatum] gb|PHU12872.1| hypothetical protein BC332_19802 [Capsicum chinense] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.0 bits (110), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D VK+E ARSWTQKYAMG Sbjct: 123 IAHMYKTDRVKYESTARSWTQKYAMG 148 >ref|XP_010092395.1| ubiquitin-conjugating enzyme E2-17 kDa [Morus notabilis] gb|EXB51071.1| Ubiquitin-conjugating enzyme E2-17 kDa [Morus notabilis] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.0 bits (110), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D VK+E ARSWTQKYAMG Sbjct: 123 IAHMYKTDRVKYESTARSWTQKYAMG 148 >ref|XP_009620231.1| PREDICTED: ubiquitin-conjugating enzyme E2 28 [Nicotiana tomentosiformis] ref|XP_009793718.1| PREDICTED: ubiquitin-conjugating enzyme E2 28 [Nicotiana sylvestris] ref|XP_016442650.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Nicotiana tabacum] ref|XP_016444530.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Nicotiana tabacum] ref|XP_019264896.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Nicotiana attenuata] gb|OIT36082.1| ubiquitin-conjugating enzyme e2 28 [Nicotiana attenuata] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.0 bits (110), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D VK+E ARSWTQKYAMG Sbjct: 123 IAHMYKTDRVKYESTARSWTQKYAMG 148 >ref|XP_012833973.1| PREDICTED: ubiquitin-conjugating enzyme E2 28-like [Erythranthe guttata] gb|EYU40353.1| hypothetical protein MIMGU_mgv1a015725mg [Erythranthe guttata] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTISKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.0 bits (110), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D VK+EQ ARSWT KYAMG Sbjct: 123 IAHMYKTDKVKYEQTARSWTHKYAMG 148 >ref|XP_004965488.1| ubiquitin-conjugating enzyme E2 5B [Setaria italica] gb|KQL10782.1| hypothetical protein SETIT_007428mg [Setaria italica] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.0 bits (110), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D VK+E ARSWTQKYAMG Sbjct: 123 IAHMYKTDRVKYESTARSWTQKYAMG 148 >ref|XP_002438462.1| ubiquitin-conjugating enzyme E2 28 [Sorghum bicolor] gb|EER89829.1| hypothetical protein SORBI_3010G149300 [Sorghum bicolor] Length = 148 Score = 53.1 bits (126), Expect(2) = 1e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 91 EQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 130 Score = 47.0 bits (110), Expect(2) = 1e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D VK+E ARSWTQKYAMG Sbjct: 123 IAHMYKTDRVKYESTARSWTQKYAMG 148 >gb|KQL10781.1| hypothetical protein SETIT_007428mg [Setaria italica] Length = 119 Score = 53.1 bits (126), Expect(2) = 2e-12 Identities = 26/40 (65%), Positives = 27/40 (67%) Frame = -1 Query: 256 EGWSFACAYL*ILLSICSLFTDPNPDDPLVPEIHRPYVQD 137 E WS A +LLSICSL TDPNPDDPLVPEI Y D Sbjct: 62 EQWSPALTVSKVLLSICSLLTDPNPDDPLVPEIAHMYKTD 101 Score = 47.0 bits (110), Expect(2) = 2e-12 Identities = 20/26 (76%), Positives = 21/26 (80%) Frame = -2 Query: 156 IGHMYKMDMVKHEQAARSWTQKYAMG 79 I HMYK D VK+E ARSWTQKYAMG Sbjct: 94 IAHMYKTDRVKYESTARSWTQKYAMG 119