BLASTX nr result
ID: Rehmannia29_contig00021435
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00021435 (1224 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ATI24793.1| ribosomal protein L2 (plastid) [Plukenetia volubi... 62 2e-06 gb|KCW89268.1| hypothetical protein EUGRSUZ_A01563 [Eucalyptus g... 54 6e-06 >gb|ATI24793.1| ribosomal protein L2 (plastid) [Plukenetia volubilis] Length = 513 Score = 61.6 bits (148), Expect = 2e-06 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = -2 Query: 1220 FHRVIRSECYMKNISQMTEREDLGCRRSYHE 1128 FHRVIRSECYMKNISQM E+EDLGCRR+ HE Sbjct: 266 FHRVIRSECYMKNISQMKEQEDLGCRRASHE 296 >gb|KCW89268.1| hypothetical protein EUGRSUZ_A01563 [Eucalyptus grandis] Length = 77 Score = 54.3 bits (129), Expect = 6e-06 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +2 Query: 1124 IPHGMIFYILGLPVPSSGLCSSCSIQTE 1207 I H MIFYILGLPVPSSGLCSSCSIQT+ Sbjct: 50 ITHVMIFYILGLPVPSSGLCSSCSIQTK 77